topicbacklinks Backlinks to ZheningZhang in Main Web   Search all webs

Results from Main web retrieved at 17:39 (Local)

Contents Annual CEM BBQ 22 August 2014 CEM User meeting and Annual BBQ cembbq2014.pdf: 2014 flier Event: CEM user meeting Location: NYSBC, Room A 11 Time ...
CEM Microscope Schedule Please Use the New Scheduler If you do not have an account, email emg@nysbc.org Temporary EM Microscope Requests http://emg.nysbc ...
Contents CemMicroscopeTrainingArchive CEM microscope training sessions Open Training Days are microscope training sessions required before you may sign up for ...
Contents CEM microscope training sessions When there is a large enough group of new users CEM staff will hold a training/re training session. This training session ...
Contents Signup for sample prep equipment Rules signup on a first come first served basis signup with your !TwikiName list the time period you want ...
CEM Microscope Schedule CEM Microscope Allocations This process is summarized in CemSchedulingOverview Calendar below represents preallocation of microscope ...
Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols TRIAFOL METHOD Jump to Principles Holey carbon grids ...
List of NYSBC Intranet users Please take the time and add yourself to the list. To do that fill out the form in Registration. This will create an account for you ...
2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...
2dx CysZ Pseudomonas fragi Transporter 2D crystallization X380 (November 2015). 8 samples 8 samples: sample Solubilization Purification Dialysis Gel ...
2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...
Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...
Customise this topic; samples and ideas available at TWiki:TWiki.WebLeftBarCookbook. My links: My home page My activities TEMIMPS edit
Number of topics: 13
 
TWiki home
Copyright © by the contributing authors. All material on this collaboration platform is the property of the contributing authors.
Ideas, requests, problems regarding this intranet, Send feedback