Difference: TwodxClaudin15 (1 vs. 2)

Revision 210 Dec 2013 - Main.NicolasCoudray

META TOPICPARENT	name="2DCrystallizationExp"

2dx - Claudin-15: 2D crystallization

General 2dx information

General 2dx information

the protein can be frozen (still leads to 3D crystals)
stable at 4C for 2 weeks at least
23-25 kda

Changed:

<
<

Detergents: DDM, DM, OG

>
>

Detergents: they all behave similarly in the maltosides (DDM, UDM, DM) and fairly well in CHAPS. they can be exchanged into glucosides too. (The protein looks around 67kD off SEC in DM. Alex has noticed that when he prep the protein in OG, he gets some elution at 67kD, but the major peak in approx 350kD)

Properties:

sequence:

MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNMDLSKKAKLLAIAGTLHILAGACGMVAISWYAVNITTDFFNPLYAGTKYELGPALYLGWSASLLSILGGICVFSTCCCSSKEEPATRAGLPYKPSTVVIPRATSDESDISFGKYGKNAYVGLVPR

X256 - Dec 6 2013 - Sparse Matrix

Changed:

<
<

Protein in 20mM Tris pH 7.2, 150mM NaCl^?, 2% glycerol, 0.1% DM: Protein_acquisition_form-cldn15-Dec2013.doc.

>
>

Protein in 20mM Tris pH 7.2, 150mM NaCl, 2% glycerol, 0.1% DM: Protein_acquisition_form-cldn15-Dec2013.doc.

Conditions: Sparse matrix + best conditions of CDN3 (3Dx crystals, cf CDN3 twikipage).

Details: X256-CDN15_Sparse.xlsx.

Set ALLOWTOPICVIEW =

-- NicolasCoudray - 10 Dec 2013

META FILEATTACHMENT	attr="" autoattached="1" comment="" date="1386682821" name="Protein_acquisition_form-cldn15-Dec2013.doc" path="Protein_acquisition_form-cldn15-Dec2013.doc" size="60928" user="Main.NicolasCoudray" version="1"
META FILEATTACHMENT	attr="" autoattached="1" comment="" date="1386682829" name="X256-CDN15_Sparse.xlsx" path="X256-CDN15_Sparse.xlsx" size="587118" user="Main.NicolasCoudray" version="1"

Revision 110 Dec 2013 - Main.NicolasCoudray

META TOPICPARENT	name="2DCrystallizationExp"