
| Changed: | |||||||||||||||||
| < < |
| ||||||||||||||||
| > > |
| ||||||||||||||||
2dx - MDR 2D crystallization
General 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X238-239, MDR - Before-After SECProteins:
X238-239, resultsImage selection after 10 days: X238-239-MDR-ImageSelection.pptx. Mostly vesicles and aggregates. Results seem slightly better after SEC.X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx.X225, Results:Mostly aggregatesSome vesicles 2 hits with tubes:
X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||
| Deleted: | |||||||||||||||||
| < < |
| ||||||||||||||||
| |||||||||||||||||
| Deleted: | |||||||||||||||||
| < < |
| ||||||||||||||||
| |||||||||||||||||
| Deleted: | |||||||||||||||||
| < < |
| ||||||||||||||||
| |||||||||||||||||
| Deleted: | |||||||||||||||||
| < < |
| ||||||||||||||||
| |||||||||||||||||
| Deleted: | |||||||||||||||||
| < < |
| ||||||||||||||||
| |||||||||||||||||
| Deleted: | |||||||||||||||||
| < < |
| ||||||||||||||||
| |||||||||||||||||
| Added: | |||||||||||||||||
| > > |
| ||||||||||||||||
| |||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X238-239, MDR - Before-After SECProteins:
| |||||||||||||||||||||||
| Added: | |||||||||||||||||||||||
| > > | X238-239, resultsImage selection after 10 days: X238-239-MDR-ImageSelection.pptx. | ||||||||||||||||||||||
| Added: | |||||||||||||||||||||||
| > > | Mostly vesicles and aggregates. Results seem slightly better after SEC. | ||||||||||||||||||||||
X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx.X225, Results:Mostly aggregatesSome vesicles 2 hits with tubes:
X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||
| Added: | |||||||||||||||||||||||
| > > | |||||||||||||||||||||||
| |||||||||||||||||||||||
| Added: | |||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||
| |||||||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||
| > > | X238-239, MDR - Before-After SECProteins:
| ||||||||||||||||||||||||
X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx.X225, Results:Mostly aggregatesSome vesicles 2 hits with tubes:
X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||||
| |||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx. | |||||||||||||||||||
| Changed: | |||||||||||||||||||
| < < | * X225_mdr-if.ppt: X225_mdr-if.ppt | ||||||||||||||||||
| > > | X225, Results: | ||||||||||||||||||
| Added: | |||||||||||||||||||
| > > | Mostly aggregates Some vesicles 2 hits with tubes:
| ||||||||||||||||||
| Added: | |||||||||||||||||||
| > > | Details: X225_mdr-if.ppt. | ||||||||||||||||||
X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||
| Changed: | |||||||||||||||||||
| < < |
| ||||||||||||||||||
| > > |
| ||||||||||||||||||
| |||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx. | |||||||||||||||||||
| Added: | |||||||||||||||||||
| > > | * X225_mdr-if.ppt: X225_mdr-if.ppt | ||||||||||||||||||
X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||
| Deleted: | |||||||||||||||||||
| < < | * mdr-if.ppt: mdr-if.ppt | ||||||||||||||||||
| Deleted: | |||||||||||||||||||
| < < | * X225_mdr-if.ppt: X225_mdr-if.ppt d162 1 | ||||||||||||||||||
| |||||||||||||||||||
| Changed: | |||||||||||||||||||
| < < |
| ||||||||||||||||||
| > > |
| ||||||||||||||||||
| |||||||||||||||||||
| Deleted: | |||||||||||||||||||
| < < |
| ||||||||||||||||||
2dx - MDR 2D crystallization
General 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx.X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||||||
| > > | * X225_mdr-if.ppt: X225_mdr-if.ppt d162 1 | ||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
| Changed: | |||||||||||||||||||||||||||||||||
| < < |
| ||||||||||||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
2dx - MDR 2D crystallization
General 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx.X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||||||
| > > | * mdr-if.ppt: mdr-if.ppt | ||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||
| > > | X225, MDR (Aug 15) - Incomplete Factorial MatrixTwo fractions: fraction15 (1.1mg/ml-440ul) and fraction16 (1.47mg/ml-440ul). Matrix details: X225-MDR-IF.xlsx. | ||||||||||||||||||||||||
X222, MDR - Lipids, LPR, time-course, rateConditions:
X222, resultsImage selection: X222-MDR-ImageSelection.pptx. Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found.X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||||
| |||||||||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X222, MDR - Lipids, LPR, time-course, rateConditions:
| |||||||||||||||||
| Added: | |||||||||||||||||
| > > | X222, resultsImage selection: X222-MDR-ImageSelection.pptx. | ||||||||||||||||
| Added: | |||||||||||||||||
| > > | Mostly aggregates/clusters of sheets and vesicles (or aggregates of vesicles only when buttons are used). Same results at higher LPRs or with other lipid, or solubilizing E.coli in OG instead of DDM. 1 tube with slight diffraction found. | ||||||||||||||||
X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||
| Added: | |||||||||||||||||
| > > | |||||||||||||||||
| |||||||||||||||||
| Added: | |||||||||||||||||
| > > |
| ||||||||||||||||
| |||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||||
| > > | X222, MDR - Lipids, LPR, time-course, rate | ||||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||||
| > > | Conditions:
| ||||||||||||||||||||||||||||||
X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)Trials set with frozen MDR remaning from previous experiments (3 different batches). See details: X218-MDR_frozen.xlsx. Buffer was changed 1x/day and had 2 mM MBCD.X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx.It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||||||||
| Deleted: | |||||||||||||||||||||||||||||||
| < < | d150 1 | ||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X218, MDR - Repeat with 3 frozen MDRs (July 18 2013) | |||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||
| > > | Trials set with frozen MDR remaning from previous experiments (3 different batches). | ||||||||||||||||||||||||||||
| See details: X218-MDR_frozen.xlsx. | |||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||
| > > | Buffer was changed 1x/day and had 2 mM MBCD. | ||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||
| > > | X218, resultsImage selection: X218-Frozen_MDR-ImageSelection.pptx. | ||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||
| > > | It seems that there is much more 'material' on the grid than what we had when they were fresh (is it because most of the protein died and we have more lipid per protein alive, or is it because the protein like it...?). We have several non-diffracting sheets/vesicles, and for 2 conditions with very rare diffracting tubes (the best diffraction I've seen for tubes in neg stain so far). Note these 2 conditions (LPR 0.45 and 0.55) come from the same batch which gave MDR crystals the first time (but they are rare, so it may be a coincidence). So either: ** this particular batch was somehow better ** the crystallization is sensitive to LPR, or to rate (buffer changed 1x/day instead of 2), or to when the conditions are harvested ** MDR likes only 1 component of the E.coli lipid (PG, PE or Ca) - so crystals are rare | ||||||||||||||||||||||||||||
X214, MDR - Detergent, Temperature, pHConditions:
X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. Image selection: X214-MDR-ImageSelection.pptx.x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||||
| > > | d150 1
| ||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
2dx - MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)See details: X218-MDR_frozen.xlsx.X214, MDR - Detergent, Temperature, pHConditions:
| |||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||
| > > | X214, Results:A few sheets and aggregates, but grids look almost empty - no pattern. | ||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||
| > > | Image selection: X214-MDR-ImageSelection.pptx. | ||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||
| > > | |||||||||||||||||||||||||||
x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||||
| > > |
| ||||||||||||||||||||||||||
| |||||||||||||||||||||||||||
| |||||||||||||||
| Changed: | |||||||||||||||
| < < | 2dx - <MDR 2D crystallization | ||||||||||||||
| > > | 2dx - MDR 2D crystallization | ||||||||||||||
General 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||||||
| Added: | |||||||||||||||
| > > | X218, MDR - Repeat with 3 frozen MDRs (July 18 2013)See details: X218-MDR_frozen.xlsx. | ||||||||||||||
X214, MDR - Detergent, Temperature, pHConditions:
x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||
| Added: | |||||||||||||||
| > > | |||||||||||||||
| |||||||||||||||
| Added: | |||||||||||||||
| > > |
| ||||||||||||||
| |||||||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||||||||||||||||
| Added: | |||||||||||||||||||||||||
| > > | X214, MDR - Detergent, Temperature, pHConditions:
| ||||||||||||||||||||||||
x205 - pH, MgCl2, lipidsConditions:
X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
x205 - pH, MgCl2, lipidsConditions: | |||||||||||||||
| Changed: | |||||||||||||||
| < < |
| ||||||||||||||
| > > |
| ||||||||||||||
| |||||||||||||||
| Added: | |||||||||||||||
| > > | X205, ResultsImage selection: X205-MDR-ImageSelection.pptx.A few rare sheets with E.coli, but no pattern. Other lipids did not give anything good. | ||||||||||||||
x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||
| Added: | |||||||||||||||
| > > | |||||||||||||||
| |||||||||||||||
| Added: | |||||||||||||||
| > > |
| ||||||||||||||
| |||||||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||||||||||||||
| Changed: | |||||||||||||||||||||||
| < < | Note: Andreas got crystals when solubilizing the lipid in OG (at LPR 0.2 and later at LPR 1.0) | ||||||||||||||||||||||
| > > | Note: Andreas got crystals when solubilizing the lipid in OG (at LPR 0.2 and later at LPR 0.5) | ||||||||||||||||||||||
x205 - pH, MgCl2, lipidsConditions:
x202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||
| Added: | |||||||||||
| > > | x205 - pH, MgCl2, lipidsConditions:
| ||||||||||
| Changed: | |||||||||||
| < < | 202 - MDR - Sparse Matrix + other lipids | ||||||||||
| > > | See detailed matrix: X205-MDR.xlsx. | ||||||||||
| Added: | |||||||||||
| > > |
x202 - MDR - Sparse Matrix + other lipids | ||||||||||
| Protein acquisition form: x202-Protein_Acquisition_MDR.doc. Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||
| Added: | |||||||||||
| > > | |||||||||||
| |||||||||||
| Added: | |||||||||||
| > > |
| ||||||||||
| |||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. | |||||||||||||||
| Added: | |||||||||||||||
| > > | X202, ResultsSee image selection: X202-MDR_ImageSelection.pptx.1 condition gives crystalline sheet-like structure: E.coli lipid in DDM, pH 6, 50 mM MgCl2, 100 mM NaCl, temperature cycling, dialysed for 10 days. | ||||||||||||||
| Added: | |||||||||||||||
| > > | |||||||||||||||
X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||||||
| Added: | |||||||||||||||
| > > |
| ||||||||||||||
| |||||||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG Thermostability assay with different detergents:
| |||||||||||
| Added: | |||||||||||
| > > | 202 - MDR - Sparse Matrix + other lipidsProtein acquisition form: x202-Protein_Acquisition_MDR.doc.Sparse matrix has been set. (LPR 0.2-0.95). Also, 4 lipids tested in the purification buffer @27C: E.coli (OG), DMPC (DDM), Cardiolipin (DM), Cardiolipin:brain (C12E7). Microdialysis plate used. See details: X202-MDR.xlsx. Note: 2 fractions from the peak (15: 0.8 mg/ml; 16: 0.75); Fraction 15 for rows A to D; and fraction 16 for rows E to G. | ||||||||||
X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
| |||||||||||
| Added: | |||||||||||
| > > | Results, X191See image selection: ralph_X191_mdr.pptx.Mostly small vesicles. | ||||||||||
Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||
| Deleted: | |||||||||||
| < < | * ralph_X191_mdr.pptx: ralph_X191_mdr.pptx | ||||||||||
| Added: | |||||||||||
| > > |
| ||||||||||
| |||||||||||
| Added: | |||||||||||
| > > |
| ||||||||||
| |||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG | ||||||||
| Added: | ||||||||
| > > | Thermostability assay with different detergents:
| |||||||
X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| ||||||||
| Added: | ||||||||
| > > |
| |||||||
| ||||||||
| Deleted: | ||||||||
| < < |
| |||||||
| ||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||
| Added: | |||||||||
| > > | * ralph_X191_mdr.pptx: ralph_X191_mdr.pptx | ||||||||
| |||||||||
| Added: | |||||||||
| > > |
| ||||||||
| |||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
| |||||||||||
| Added: | |||||||||||
| > > | Thermostability assay (Marisa)See lipids_MDR_thermo_assay.ppt (The number on the left (on top) is the best temperature for MDR under different conditions. The control sample is MDR with the same buffer used in the purification).The best lipid will have the highest temperature: DMPC > DOPE > Control Then, lipids which decrease the melting temperature: Control > DOPC>>DOPA>DOPS>POPC>DOPG | ||||||||||
| Deleted: | |||||||||||
| < < | d31 1 | ||||||||||
X191 - MDR - lipidsProtein: Protein_Acquisition_MDR.doc.Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| |||||||||||
| Deleted: | |||||||||||
| < < | * Protein_Acquisition_MDR.doc: Protein_Acquisition_MDR.doc | ||||||||||
| Added: | |||||||||||
| > > |
| ||||||||||
| |||||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
| ||||||||
| Changed: | ||||||||
| < < |
| |||||||
| > > | MQRIIQFFSQRATTLFFPMALILYDFAAYLTTDLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGALIFTLACAATLLTTSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMGLLALCGLLLAMPETVQRGAVPFSAVSVLRDFRNVFRNPIFLTGAATLSLSYIPMMSWVAVSPVILIDAGGMSTSQFAWAQVPVFGAVIVANMIVVRLVKDPTRPRFIWRAVPIQLSGLATLLLGNLLLPHVWLWSVLGTSLYAFGIGMIFPTLFRFTLFSNNLPKGTVSASLNMVILTVMAVSVEVGRWLWFHGGRLPFHLLAAVAGVIVVFTLATLLQRVRQHEAAELAAEK | |||||||
| Added: | ||||||||
| > > |
| |||||||
| ||||||||
| Changed: | ||||||||
| < < |
| |||||||
| > > |
| |||||||
d31 1
X191 - MDR - lipids | ||||||||
| Added: | ||||||||
| > > | Protein: Protein_Acquisition_MDR.doc. | |||||||
Objective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C.
As a lot of protein has been received, so device and other lipids have also been tested:
Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
| ||||||||
| Added: | ||||||||
| > > | * Protein_Acquisition_MDR.doc: Protein_Acquisition_MDR.doc | |||||||
| ||||||||
| Added: | ||||||||
| > > |
| |||||||
| ||||||||
2dx - <MDR 2D crystallizationGeneral 2dx information
X191 - MDR - lipidsObjective: reeproduce Andreas' results. Since the robot does not work, cyclodextrin was added over 3 days at 27C manually (3 times to reach a 1:3 ratio), then placed at 37C. As a lot of protein has been received, so device and other lipids have also been tested:
Experiments from Andreas EngelSee MDR_–_Andreas_summary.pptx. E.coli + EDTA (no divalent salt), pH 7.5 purification buffer seems to give crystals. MgCl?, CaCl? and DMPC also tested but not as good.
|