topicbacklinks Backlinks to AndreasEngel in Main Web   Search all webs

Results from Main web retrieved at 09:17 (Local)

Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...
List of NYSBC Intranet users Please take the time and add yourself to the list. To do that fill out the form in Registration. This will create an account for you ...
TEMIMPS Annual Meeting, April 19, 2011 TEMIMPS annual meeting agenda.doc: Agenda TEMIMPS annual meeting materials.pdf: Meeting Materials TEMIMPS Guests ...
TEMIMPS annual meeting materials.doc: meeting materials workshop agenda 4 10 2012.doc: Pre meeting workshop TemimpsMeetingSchedule2012 Attending Title ...
Transcontinential Initiative for Membrane Protein Structure Meetings Temimps Monthly Meetings TemimpsAnnualMeeting2013 TemimpsAnnualMeeting2012 ...
Contents TEMIMPS members Iban Ubarretxena , Andreas Engel , Pawel Penczek , Tamir Gonen , James Love , David Stokes cc: Changki Kim , Guozhi.Tao@uth.tmc.edu, goragot ...
Schedule for the TEMIMPS Annual Meeting April 10 11, 2012 Tuesday April 10 10:00 David: detergent calculator 10:30 Nicolas: 2dx parameter matrix ...
Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...
TEMIMPS Workshop in Electron Crystallography Lecture Materials August 15 19, 2011 University of Washington School of Medicine, Seattle, Washington Lectures Lecture ...
2dx MDR 2D crystallization General 2dx information Amino acid sequence: MQRIIQFFSQRATTLFFPMALILYDFAAYLTTDLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGALIFTLACAATLLTTSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMGLLALCGLLLAMPETVQRGAVPFSAVSVLRDFRNVFRNPIFLTGAATLSLSYIPMMSWVAVSPVILIDAGGMSTSQFAWAQVPVFGAVIVANMIVVRLVKDPTRPRFIWRAVPIQLSGLATLLLGNLLLPHVWLWSVLGTSLYAFGIGMIFPTLFRFTLFSNNLPKGTVSASLNMVILTVMAVSVEVGRWLWFHGGRLPFHLLAAVAGVIVVFTLATLLQRVRQHEAAELAAEK ...
Number of topics: 10
 
TWiki home
Copyright © by the contributing authors. All material on this collaboration platform is the property of the contributing authors.
Ideas, requests, problems regarding this intranet, Send feedback