(backlinks in Main Web) VariableS < Main

NEW - 19 Sep 2014 - 14:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AaronNeiman

NEW - 10 Dec 2010 - 11:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AbeWolcott

NEW - 26 Apr 2013 - 11:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AbelNavarro

r4 - 10 Nov 2008 - 15:53

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AbrahamSpector

r2 - 30 Oct 2008 - 19:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AbrahamWolcott

NEW - 25 Feb 2013 - 14:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AdriannaTrusiak

AdriannaTrusiak

r3 - 24 Mar 2013 - 19:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AgataJacewicz

AgataJacewicz

r3 - 01 Nov 2009 - 16:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AiYamamoto

r2 - 05 Sep 2008 - 16:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AinanGeng

NEW - 05 Oct 2023 - 14:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AjayUmmat

r2 - 20 Jan 2008 - 23:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AkankshaManghrani

NEW - 02 Nov 2022 - 12:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlKatz

r2 - 25 Feb 2010 - 12:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlaaAbdine

NEW - 12 Jun 2012 - 11:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlainLefevre

NEW - 10 Jul 2008 - 15:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlanDove

r2 - 13 Jun 2010 - 10:35

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AlanHall

r3 - 08 Apr 2009 - 10:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlanSmrcka

r2 - 20 May 2009 - 14:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlbertWeixlbaumer

r5 - 02 Mar 2010 - 15:40

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

AlejandraLeoMacias

AlejandraLeoMacias

r5 - 12 Mar 2010 - 12:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet EM Home Page Personal Preferences ...

AleksandraAlimova

NEW - 08 Apr 2010 - 14:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlekseyAleshintsev

NEW - 04 Sep 2018 - 17:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlessandroVarotto

r6 - 17 Feb 2009 - 09:27

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AlexChou

NEW - 14 Sep 2011 - 08:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlexGrigoryan

NEW - 10 Oct 2011 - 11:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlexShekhtman

r11 - 28 May 2008 - 15:07

Name: Alex Shekhtman Email: ashekhta@albany.edu Company Name: SUNY A Company URL: Location: SUNYAlbany Country: USA Comment: PI ...

AlexWei

r11 - 20 Apr 2016 - 16:52

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AlexanderBeecher

NEW - 06 May 2013 - 18:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlexanderCouzis

r4 - 08 Feb 2010 - 13:03

My Links My Logbook .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

AlexanderEletsky

r8 - 01 Sep 2009 - 14:43

Name: Alexander Eletsky Login Name: aeletski Email: alex.eletski@gmx.net Company Name: SUNY B Company URL: Location: SUNYBuffaloOffice ...

AlexandraAlimova

NEW - 09 Mar 2009 - 10:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlexeiMikhailov

r3 - 14 Aug 2007 - 13:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlexejJerschow

r10 - 10 Dec 2008 - 17:46

Name: Alexej Jerschow Email: alexej.jerschow@nyu.edu Company Name: NYU Company URL: http://www.nyu.edu/projects/jerschow/ Location: NYUOffice ...

AlexisJaramillo

r3 - 23 Sep 2013 - 12:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AliciaSponholz

NEW - 28 Jan 2015 - 18:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlidaDematteo

r2 - 17 Apr 2019 - 14:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlisonRinderspacher

NEW - 28 May 2026 - 15:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlistairSiebert

r3 - 05 Nov 2007 - 00:23

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AllanCapili

r7 - 12 Dec 2007 - 11:18

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AllenSpiegel

r7 - 17 Apr 2019 - 14:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AllenSun

NEW - 30 Aug 2023 - 11:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AllysonBunbury

r4 - 17 Apr 2019 - 14:08

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AlmarexParedes

NEW - 28 Oct 2015 - 09:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AlvinLu

r3 - 14 May 2012 - 16:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmedeeDesGeorges

r2 - 25 Feb 2009 - 14:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmedeedesGeorges

r2 - 14 Sep 2009 - 16:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmirGoldbourt

r8 - 02 Aug 2010 - 13:55

Name: Amir Goldbourt Email##: ag2354 at columbia.edu % no longer working, Sep 12 2007 Company Name: Columbia University Company URL: http://www ...

AmitSinger

r6 - 14 Nov 2008 - 12:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmitSitt

NEW - 05 Mar 2015 - 13:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmponSaeher

NEW - 15 Jan 2015 - 14:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmyGrunbeck

r3 - 19 Aug 2008 - 18:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmyJobe

r2 - 06 Dec 2011 - 17:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmyReichel

r3 - 01 Sep 2009 - 23:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AmyWilkerson

NEW - 01 Aug 2013 - 10:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnaAsenjo

r3 - 17 Apr 2019 - 14:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnaVasileva

r2 - 25 Feb 2010 - 08:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnandKatragadda

AnandKatragadda

r4 - 10 Jan 2007 - 15:04

Name: Anand Katragadda Email: anandkatragadda@gmail.com Company Name: TSP Company URL: Location: ParkBuildingOffice Country: USA Comment ...

AnandaGhosh

r2 - 30 Dec 2013 - 16:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnantMenon

NEW - 07 May 2014 - 15:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnastasiaVoevodin

NEW - 14 Mar 2015 - 15:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnchiCheng

NEW - 17 Feb 2015 - 15:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndishehAbedini

r4 - 20 Nov 2009 - 11:42

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

AndrasBauer

r3 - 01 Mar 2010 - 11:14

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

AndrasFiser

r4 - 17 Apr 2019 - 14:09

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AndreaCalifano

r3 - 10 Jul 2008 - 16:30

Name: Andrea Califano Email: califano@dbmi.columbia.edu Company Name: Columbia U P S Company URL: http://www.dbmi.columbia.edu/califano/dbmi/ Location ...

AndreaNans

r14 - 20 Nov 2009 - 12:24

Name: Andrea Nans Email: andrea.nans@gmail.com Company Name: New York University Company URL: http://saturn.med.nyu.edu/research/sb/stokeslab/ ...

AndreaPiserchio

r3 - 10 Dec 2010 - 11:11

Name: Andrea Piserchio Email: andrea.piserchio@gmail.com Company Name: CUNY Company URL: Location: CUNYCCNY Country: USA Comment: ...

AndreasEngel

r2 - 24 Sep 2009 - 22:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndreiKouranov

r3 - 31 Mar 2008 - 09:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndrejSali

AndrejSali

NEW - 09 Sep 2004 - 17:54

Name: Andrej Sali Email: sali@salilab.org Company Name: UCSF Company URL: http://salilab.org Location: (Please specify office location) Country ...

AndrewByro

r3 - 19 Oct 2009 - 17:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndrewHsu

NEW - 18 Feb 2016 - 11:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndrewMahon

NEW - 19 Aug 2011 - 13:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndrewMutter

r2 - 09 Dec 2009 - 11:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AndrewPomfret

r7 - 19 Jan 2010 - 16:04

Name: Andrew Pomfret Email%: Company Name: NYU School of Medicine Company URL: http://saturn.med.nyu.edu/~stokes/ Location: NYUSoMOffice ...

AndrewStewart

r3 - 14 Aug 2007 - 13:35

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AneelAggarwal

r13 - 01 Apr 2009 - 13:38

Name: Aneel Aggarwal Email: Aneel.Aggarwal@mssm.edu Company Name: MSSM Company URL: http://atlas.physbio.mssm.edu/~aagroup/ Location: MSSM ...

AngelaBrown

r2 - 15 Sep 2009 - 10:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AngelicaFerguson

r5 - 21 Apr 2016 - 09:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AngeloGunasekera

r2 - 12 Dec 2008 - 18:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AngieFeng

NEW - 19 Jan 2016 - 18:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnilKorkut

r2 - 23 Oct 2008 - 07:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AninditaGayen

NathanielTraaseth

r2 - 08 Dec 2013 - 16:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnirbanBanerjee

AnirbanBanerjee

NEW - 01 Mar 2006 - 19:19

Name: Anirban Banerjee Email: abanerjee@mail.rockefeller.edu Company Name: Rockefeller University Company URL: http://www.rockefeller.edu/labheads/mackinnon ...

AnishShivamani

NEW - 09 Sep 2024 - 11:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnjeliqueSawh

NEW - 19 Aug 2019 - 17:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnnMarieSchmidt

r2 - 23 Nov 2009 - 11:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnnMcDermott

r22 - 13 Nov 2009 - 19:53

Name: Ann McDermott Email: aem5@columbia.edu Company Name: Columbia University Company URL: http://www.cise.columbia.edu/nsec/team/mcdermott.html ...

AnnWehman

r3 - 20 Nov 2009 - 12:19

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

AnnaKaplan

r2 - 19 Jan 2010 - 12:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnnaKruyer

AnnaKruyer

r2 - 10 Jun 2013 - 16:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnnaPiasecka

r3 - 17 Apr 2019 - 14:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnneBresnick

r3 - 17 Apr 2019 - 14:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnneMuesch

r3 - 17 Apr 2019 - 14:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnnieZheng

r12 - 09 Dec 2009 - 13:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnouckChampsaur

NEW - 20 Aug 2014 - 12:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnsgarSiemer

r4 - 08 Feb 2010 - 13:02

My Links My Logbook .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest ...

AntoniosPapaioannou

AntoniosPapaioannou

r2 - 17 Feb 2015 - 18:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnupamPatgiri

NEW - 15 Sep 2010 - 08:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AnuttaraUdomprasert

NEW - 25 Mar 2011 - 16:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AparnaTalekar

NEW - 24 Aug 2011 - 13:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AprilKillikelly

r2 - 29 Nov 2009 - 20:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArianneMorrison

ArianneMorrison

r93 - 14 Jul 2009 - 10:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArjunKoshal

NEW - 22 Feb 2019 - 10:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArkyAsmal

NEW - 16 Jul 2014 - 17:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArmandoDelRio

r4 - 28 Feb 2009 - 16:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArpitaTawani

ArpitaTawani

r2 - 02 Aug 2022 - 11:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArthurEdison

r2 - 15 Oct 2008 - 08:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArthurKarlin

NEW - 27 Mar 2008 - 11:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ArthurPalmer

r23 - 17 Feb 2010 - 12:16

Name: Arthur Palmer Email: agp@nysbc.org Company Name: Columbia Univ. Medical Center Company URL: http://www.palmer.hs.columbia.edu Location: ColumbiaMedCenterOffice ...

ArunachalamAlagappan

NEW - 25 Sep 2014 - 11:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AshleeAppoloney

NEW - 17 Feb 2015 - 15:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AshleighRaczkowski

AshleighRaczkowski

r5 - 11 Jul 2017 - 13:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AshleyAstacio

NEW - 09 Sep 2010 - 12:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AswinN

NEW - 28 Mar 2019 - 16:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AswinNatarajan

r2 - 10 May 2006 - 13:25

Name: Aswin Natarajan Email: anatarajan@gc.cuny.edu Company Name: CCNY CUNY Company URL: http://www. Location: CUNYCCNYOffice Country: USA ...

AtsuhitoSuzuki

NEW - 12 Feb 2007 - 10:31

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

AuroraPujol

NEW - 21 Mar 2012 - 12:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AvromCaplan

r2 - 20 May 2009 - 14:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

AymenYassin

r2 - 10 Jan 2010 - 15:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BTracyNixon

r2 - 30 Oct 2008 - 13:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BarnaliChaudhuri

r3 - 09 Aug 2010 - 16:13

MyLogbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

BartlomiejBlus

BartlomiejBlus

r2 - 02 Apr 2014 - 15:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BenjaminChen

BenjaminChen

r2 - 20 Nov 2013 - 14:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BenjaminMartial

BenjaminMartial

r2 - 04 Nov 2020 - 10:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BenjaminReed

r3 - 12 Sep 2013 - 16:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BenjaminWylie

r2 - 19 Nov 2009 - 09:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BernardEverson

NEW - 31 Aug 2011 - 13:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BernhardDorweiler

r2 - 08 Mar 2009 - 12:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BethCharles

r2 - 23 Jun 2009 - 09:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BethGeorge

NEW - 18 Jan 2007 - 13:20

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BetramCanagarajah

NEW - 15 May 2019 - 11:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BhaminiVaidialingam

NEW - 15 Sep 2010 - 17:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BillBartsch

r2 - 29 Sep 2009 - 13:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BillRice

r58 - 05 Mar 2015 - 19:28

Name: Bill Rice Email: rice@nysbc.org Company Name: Company URL: http://www. Location: ParkBuildingOffice Country: USA Comment: CEM ...

BinHe

r3 - 20 Sep 2007 - 13:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BinduRaveendra

r4 - 03 Dec 2008 - 16:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BingShan

r2 - 14 Apr 2009 - 13:18

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BingquanLi

r4 - 20 Nov 2009 - 11:43

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

BingwuYu

RuthStark

r3 - 13 Sep 2007 - 19:49

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

BinojJose

BinojJose

r3 - 07 Apr 2008 - 10:17

Name: Binoj Jose Email: bjose@tspllc.com Company Name: TSP Company URL: Location: ParkBuildingOffice Country: USA Comment: Consultant ...

BoChen

r2 - 24 Sep 2008 - 11:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BoChenCryo

r2 - 14 Sep 2009 - 14:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BobDarnell

r5 - 20 Oct 2008 - 08:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BorisArshava

NEW - 12 Jun 2007 - 15:31

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

BorisItin

r4 - 02 Sep 2010 - 09:29

Name: Boris Itin Email: bitin@nysbc.org Company Name: nysbc Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country: USA ...

BowuLuan

NEW - 09 Sep 2010 - 12:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BoyanPenkov

NEW - 10 Dec 2014 - 11:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BrandanHillerich

r2 - 11 Oct 2007 - 12:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BrandyBennett

r2 - 02 Aug 2009 - 22:28

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BrentStockwell

r2 - 29 May 2007 - 13:16

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BrianChait

r10 - 02 Apr 2009 - 09:55

Name: Brian Chait Email: chait@rockefeller.edu Company Name: Rockefeller U Company URL: http://www.rockefeller.edu/research/abstract.php?id 18 http ...

BrianHouckLoomis

r4 - 23 Sep 2007 - 23:15

BrianKloss

BrianKloss

r26 - 26 Nov 2014 - 14:20

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BrianNeel

NEW - 26 Jun 2014 - 14:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BrianPhillips

r2 - 24 Feb 2008 - 16:42

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

BrianStockman

r3 - 07 Apr 2009 - 12:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BrianWengerter

r4 - 14 Aug 2007 - 13:37

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BridgetCarragher

NEW - 12 Sep 2014 - 12:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BridgetHuang

NEW - 13 Oct 2010 - 11:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BrisaHurlocker

NEW - 27 Sep 2011 - 13:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BrookeNichole

NEW - 30 Aug 2011 - 13:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BruceGelb

r2 - 22 Jan 2010 - 19:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BruceJohnson

r4 - 24 Nov 2008 - 10:46

Name: Bruce Johnson Email: bruce@onemoonscientific.com Company Name: One Moon Scientific, Inc. Phone: 908 517 5105 Company URL: http://www.onemoonscientific ...

BruceKline

r5 - 05 Nov 2007 - 15:19

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

BruceMcEwen

BruceMcEwen

NEW - 15 Aug 2005 - 18:04

Name: Bruce McEwen Email: bruce@wadsworth.org Company Name: Wadsworth Center Company URL: http://www. Location: WadsworthOffice Country: USA ...

BrunoBitin

r3 - 22 Apr 2009 - 23:35

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

BryanTsou

r2 - 05 Jun 2012 - 16:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BudimirZdravkovic

NEW - 14 Sep 2012 - 10:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

BurenLi

NEW - 17 Mar 2015 - 15:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CaijieZhao

r3 - 21 Jan 2009 - 16:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CaitlinQuinn

r3 - 22 Jan 2008 - 17:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CallieSaeher

NEW - 04 Apr 2017 - 11:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CamillePadlan

r3 - 12 Sep 2011 - 14:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarlMachutta

r2 - 22 Jul 2008 - 21:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarlNegro

NEW - 15 Jun 2015 - 11:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarlaRospigliosi

r2 - 17 Oct 2007 - 10:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarlaTheimer

r2 - 25 Feb 2010 - 10:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarlosMeriles

r2 - 29 May 2007 - 13:17

Name: Carlos Meriles Email: cmeriles@sci.ccny.cuny.edu Company Name: City College of New York CUNY Company URL: Location: CUNYOffice Country ...

CarlosdelosSantos

r5 - 20 Mar 2009 - 12:25

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

CarmenDrahl

r5 - 02 Jun 2010 - 10:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarmenMannella

r3 - 18 Sep 2006 - 22:56

Name: Carmen Mannella Email: carmen@wadsworth.org Company Name: Wadsworth Company URL: http://www.wadsworth.org Location: WadsworthOffice ...

CarolWoodMoore

r4 - 02 Nov 2009 - 15:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarolinaAduraAlcaino

NEW - 09 Aug 2013 - 09:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CarolinaCarvalho

r3 - 14 Aug 2007 - 13:39

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

CatherineMurray

r2 - 07 Jul 2008 - 13:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CathleenCastello

NEW - 29 Jan 2019 - 11:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CedricBernard

r2 - 28 Jan 2010 - 20:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CeliaTorres

r3 - 05 May 2008 - 19:23

Name: Celia Torres Email: Celia.Torres@mssm.edu Company Name: Mount Sinai School of Medicine Company URL: http://www.mssm.edu/ Location: MSSMOffice ...

CemRobotTechGuide

NicolasCoudray

r33 - 23 Feb 2011 - 16:33

Contents Leginon/Robot Technical Guide Minghui robot tech guide.doc: Robot Technical Guide (MS Word format) Leginon Update As of Feb 2010, Leginon is under major ...

ChangWookLee

r2 - 14 Feb 2008 - 15:33

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ChangkiKim

r3 - 10 Jan 2011 - 11:29

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

CharlesDecicco

CharlesDecicco

NEW - 23 Jan 2006 - 10:19

Name: Charles Decicco Email: cdecicco@ccny.cuny.edu Company Name: CCNY CUNY Company URL: http://www. Location: CUNYCCNYOffice Country: USA ...

CharlesRice

r4 - 19 Nov 2013 - 12:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChenWu

r2 - 07 Jul 2008 - 14:58

Name: Chen Wu Email: cwu@saturn.med.nyu.edu Company Name: NYUSOM Company URL: http://www. Location: NYUSoMOffice Country: USA Comment ...

ChengWang

r2 - 17 Sep 2010 - 12:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChengWang1

NEW - 24 Aug 2011 - 15:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChenghuaYang

r2 - 02 May 2011 - 12:21

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

ChengminQian

r3 - 19 Oct 2009 - 15:40

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ChengmingHe

NEW - 13 Mar 2019 - 18:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CheriHampton

CheriHampton

r4 - 02 Dec 2008 - 14:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChiWang

NEW - 20 Sep 2012 - 17:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChiaHsuehLee

NEW - 29 Jul 2015 - 20:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChiaoyungSu

r5 - 01 Oct 2008 - 11:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChiaraPastore

r2 - 04 Nov 2007 - 15:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChiaraRapisarda

r2 - 05 Oct 2009 - 10:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChinHLin

ChinHLin

NEW - 17 Dec 2004 - 10:27

Name: Chin H. Lin Email: chin.lin@nyu.edu Company Name: New York University Company URL: Location: NYUOffice Country: USA Comment: ...

ChingHwaSung

r4 - 20 Nov 2009 - 12:45

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

ChingShinHuang

r3 - 17 Apr 2012 - 15:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChrisCrocker

r2 - 17 Dec 2008 - 16:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChrisGinter

NEW - 25 Jun 2014 - 15:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChrisLima

r8 - 20 Aug 2009 - 17:28

Name: Chris Lima Email: limac@mskcc.org Company Name: MSKCC Company URL: http://www.mskcc.org/lima Location: MSKCCOffice Country: USA ...

ChrisPetzold

r3 - 02 Dec 2011 - 13:52

Name: Chris Petzold Email: Chris.Petzold@nyumc.org Company Name: NYUSOM Company URL: http://www. Location: NYUSoMOffice Country: USA ...

ChrisWarren

NEW - 03 Feb 2017 - 14:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChrisWilson

NEW - 14 May 2010 - 11:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristianRenken

r2 - 17 Oct 2007 - 17:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristianSorensen

NEW - 18 Feb 2016 - 11:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristineChrissian

NEW - 20 Aug 2015 - 08:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristophWigge

NEW - 31 Mar 2015 - 10:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristophePejoux

r3 - 25 Jan 2007 - 12:48

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ChristopherFields

r2 - 15 Sep 2009 - 16:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristopherPetzold

r2 - 07 Feb 2011 - 12:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChristopherWilhelm

r3 - 14 Aug 2007 - 13:39

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ChristopherWilson

r2 - 22 Dec 2009 - 16:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChuanChaoLu

ChuanChaoLu

r3 - 18 Aug 2010 - 13:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChuangP

r2 - 08 Jun 2009 - 17:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChunZhou

NEW - 16 Jun 2015 - 11:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChunhuaLiu

r2 - 16 Oct 2008 - 17:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ChunyanRen

NEW - 19 Dec 2011 - 12:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CindyFinch

NEW - 08 Sep 2006 - 13:16

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ClareGrey

r8 - 14 Apr 2009 - 13:19

Name: Clare Grey Email: cgrey@notes.cc.sunysb.edu Company Name: SUNY SB Company URL: http://www.sunysb.edu Location: SUNCYSBOffice Country ...

ClaribelNunez

NEW - 20 Jan 2012 - 10:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ClaudiaAvalos

NEW - 13 Oct 2021 - 12:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ClayBracken

NEW - 03 Jun 2025 - 13:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ClintPotter

NEW - 12 Sep 2014 - 12:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ClintPotterTest

NEW - 25 Aug 2015 - 14:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ClusterUseInstructions

r15 - 07 Feb 2011 - 10:30

Contents Cluster Usage Instructions The Computing Cluster at NYSBC is now fully operational. Requests for processing time can be made to infotech@nysbc.org. Technical ...

ColleenCourtney

NEW - 20 Sep 2011 - 08:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ColleenKennedy

NEW - 17 Feb 2010 - 14:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ConeyPeiLin

NEW - 10 Dec 2010 - 11:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CongjuChen

CongjuChen

r3 - 16 Sep 2009 - 12:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ConorCrean

r3 - 22 Sep 2009 - 08:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CorneliaHaas

r2 - 17 Feb 2010 - 08:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CraigBranch

CraigBranch

r2 - 02 Jul 2009 - 12:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CrinaNimigean

r2 - 14 Sep 2009 - 15:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CristinaGutierrezVargas

CristinaGutierrezVargas

r5 - 06 Jan 2015 - 16:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

CrystalLove

CrystalLove

r8 - 26 Mar 2018 - 12:39

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

CrystalPremo

NEW - 18 Feb 2016 - 14:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DaNengWang

r3 - 03 Apr 2009 - 12:09

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DafnaBarSagi

DafnaBarSagi

r2 - 17 Nov 2008 - 14:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DaijaBobe

NEW - 22 Oct 2015 - 14:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DamonTurney

NEW - 02 Apr 2015 - 10:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DanBogenhagen

r6 - 14 Aug 2007 - 13:41

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DanMurphy

r2 - 21 May 2009 - 15:28

Name: Dan Murphy Email: dmurphy@nysbc.org Company Name: Company URL: Location: ParkBuildingOffice Country: USA Comment: Personal ...

DanRaleigh

r4 - 17 Nov 2008 - 08:38

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DanTurnbull

r2 - 17 Nov 2008 - 14:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DanaMoses

r6 - 12 Nov 2009 - 12:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DanielAkins

r2 - 12 Mar 2009 - 10:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DanielBruzzese

NEW - 01 Nov 2013 - 16:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DanielMontiel

NEW - 10 Feb 2016 - 11:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DanielRadoff

DanielRadoff

NEW - 13 Sep 2005 - 12:08

Name: Daniel Radoff Email: dtr2103@columbia.edu Company Name: Columbia University Company URL: Location: ColumbiaUOffice Country: USA ...

DanielSchmidt

r2 - 30 Oct 2007 - 10:30

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DanielTerry

r2 - 14 Aug 2007 - 13:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DannyHo

r2 - 24 Aug 2009 - 13:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DannyReinberg

r2 - 18 Nov 2008 - 15:48

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DariushIlghari

r3 - 28 May 2010 - 17:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DarrylAucoin

r2 - 12 Nov 2008 - 10:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DatMai

NEW - 12 Nov 2012 - 09:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DaveEstes

r4 - 30 Jul 2007 - 16:44

Name: Dave Estes Email%: Company Name: Hewlett Packard Company URL: Location: (Please specify office location) Country: USA Comment ...

DavidAllis

r3 - 30 Sep 2009 - 15:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidBaker

r4 - 24 Sep 2009 - 19:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidBorah

r3 - 03 Oct 2008 - 16:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidCallaway

r6 - 11 Jun 2008 - 09:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidCowburn

r277 - 04 Nov 2025 - 11:06

Name: David Cowburn Login Name: cowburn Email: david.cowburn@einsteinmed.edu Location: Einstein Address: DavidCowburnAddress Einstein Web ...

DavidEliezer

r24 - 19 Nov 2008 - 13:01

Name: David Eliezer Email: dae2005@med.cornell.edu Company Name: WMCCU Company URL: http://www.med.cornell.edu/research/deliezer/ Location: WMCCU ...

DavidFenyo

DavidFenyo

NEW - 26 Apr 2006 - 13:01

Name: David Fenyo Email: fenyo@rockefeller.edu Company Name: Rockefeller University Company URL: http://www.rockefeller.edu Location: RockefellerUOffice ...

DavidFidock

r2 - 14 Jan 2010 - 17:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidFushman

r2 - 05 Oct 2009 - 11:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidGrandy

r2 - 14 Sep 2006 - 16:10

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DavidHall

r6 - 17 Aug 2010 - 16:22

My User Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

DavidHernandez

NEW - 16 Sep 2013 - 20:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidHirsh

r5 - 23 Jan 2009 - 15:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidHorita

DavidHorita

NEW - 17 Aug 2005 - 10:05

Name: David Horita Email: dhorita@wfubmc.edu Company Name: Wake Forest University School of Medicine Company URL: http://www1.wfubmc.edu/biochem ...

DavidHorstman

NEW - 19 Jun 2014 - 13:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidIaea

NEW - 22 Apr 2015 - 20:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidLeMaster

r5 - 30 Jul 2007 - 17:05

Name: David LeMaster Email: lemaster@wadsworth.org Company Name: Wadsworth Company URL: Location: WadsworthOffice Country: USA Comment ...

DavidLive

r5 - 11 Oct 2007 - 15:14

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

DavidMcGarvey

r5 - 10 Mar 2010 - 08:31

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DavidMelnekoff

NEW - 26 Jan 2015 - 12:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidRon

r2 - 12 Dec 2007 - 10:20

Name: David Ron Company Name: NYUSoM Company URL: http://saturn.med.nyu.edu/research/mp/ronlab/index.html Location: NYUOffice Country: USA ...

DavidRumschitzki

r3 - 04 Jan 2010 - 11:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidScott

NEW - 31 Mar 2022 - 18:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidSnead

NEW - 13 Jan 2012 - 13:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidStokes

r33 - 16 Jan 2015 - 11:36

Name: David Stokes Email: stokes@nyu.edu Company Name: NYU Company URL: http://stokeslab.med.nyu.edu Location: Skirball Institute 3 13 Country ...

DavidTareste

r6 - 12 Nov 2009 - 12:52

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DavidTevault

r4 - 05 May 2008 - 08:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidVuletich

r4 - 14 Feb 2009 - 12:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DavidWah

r2 - 08 Feb 2008 - 23:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DebbieTrifilio

NEW - 30 May 2017 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DeborahPalliser

NEW - 19 Dec 2013 - 19:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DeborahStonerMa

NEW - 31 Oct 2008 - 12:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DeenaOren

r2 - 14 Dec 2007 - 13:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DeniseSchuetz

r2 - 16 Oct 2009 - 14:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DenizTemel

r15 - 05 Mar 2013 - 09:19

Name: Deniz B Temel Occupation: PhD Student in Physics in The City University of New York, Graduate Center Email: dbtemel@gmail.com Company Name ...

DennisTorchia

r4 - 09 Jul 2008 - 16:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DerekTan

NEW - 29 Jun 2015 - 11:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DerekTaylor

NEW - 09 May 2011 - 12:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DevendraSrivastava

r2 - 05 May 2015 - 11:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DevrimAcehan

r82 - 20 Nov 2009 - 12:31

Name: Devrim Acehan Email: acehan@saturn.med.nyu.edu Company Name: NYU Skirball Institute Company URL: Location: NYUSoMOffice Country: USA ...

DhireshVyas

r4 - 22 Jul 2008 - 06:37

Name: Dhiresh Vyas Login Name: dvyas Email: dvyas@tspllc.com Phone: Department: Location: NYSBC Comment: Personal Preferences (details ...

DianamCalderon

NEW - 07 May 2014 - 15:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DianeTabarini

r2 - 12 Mar 2008 - 10:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DianneCarpen

DianneCarpen

r2 - 16 May 2023 - 10:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DickensStHilaire

NEW - 09 Sep 2010 - 11:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DimitarNikolov

NEW - 19 Aug 2009 - 09:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DimitrisSakellariou

r2 - 22 Apr 2009 - 23:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DinahFarrington

NEW - 28 Jan 2011 - 11:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DinshawPatel

r7 - 02 Apr 2009 - 10:49

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DirkRemus

NEW - 02 Aug 2012 - 12:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DivyarajDesai

NEW - 26 Apr 2012 - 17:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DjemilImane

r11 - 30 Jul 2007 - 16:11

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

DmitryFyodorov

NEW - 16 Nov 2015 - 13:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DonaldGagne

NEW - 01 Sep 2015 - 10:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DongLee

NEW - 10 Dec 2014 - 09:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DongNiu

DongNiu

r3 - 05 Oct 2012 - 13:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DonghyunPark

NEW - 22 Oct 2015 - 16:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DongshengLiu

r4 - 30 May 2006 - 15:59

Name: Dongsheng Liu Email: dliu@nysbc.org Phone: 212 939 0660 305 Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice ...

DongyanTan

r4 - 20 Nov 2009 - 16:35

Name: dongyan tan Email: dtan@aecom.yu.edu Company Name: albert einstein college of medicine Company URL: http://www.aecom.yu.edu/home/biophysics/ ...

DongyuZhang

NEW - 20 Jan 2015 - 14:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DouglasBrawley

NEW - 02 May 2016 - 07:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DouglasKamen

DouglasKamen

NEW - 13 Jul 2005 - 09:01

Name: Douglas Kamen Email: dkamen@medusa.bioc.aecom.yu.edu Company Name: Albert Einstein College of Medicine Company URL: Location: AECOMOffice ...

DrewKennedy

r4 - 16 Sep 2008 - 12:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

DuLam

r2 - 06 Dec 2008 - 10:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EbonyGAry

NEW - 12 Jan 2012 - 15:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EbonyGary

EbonyGary

r2 - 10 Mar 2011 - 09:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EdEng

r4 - 10 Sep 2013 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet CemEngProjects Ongoing projects ...

EdmundSchwartz

r3 - 30 Jul 2007 - 17:06

Name: Edmund Schwartz Email: schware@rockefeller.edu Company Name: The Rockefeller University Company URL: http://www.rockefeller.edu Location ...

EduZabo

r2 - 07 Nov 2012 - 14:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EduardoVillarreal

r3 - 21 Apr 2016 - 09:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EdwardSnell

r2 - 14 Apr 2009 - 18:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EdwardZartler

r2 - 25 Mar 2009 - 22:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EdwinRivera

r2 - 20 Sep 2009 - 10:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ElenaYakubvskaya

r2 - 20 Nov 2009 - 12:39

Name: Elena Yakubovskaya Email: elena@pharm.stonybrook.edu Company Name: SUNY Stony Brook Company URL: http://www.pharm.stonybrook.edu/Faculty/Professors ...

EleonoraDelFederico

r3 - 12 Nov 2009 - 13:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

EliahuTaicher

r2 - 15 Jan 2009 - 17:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ElinaKopylov

r2 - 19 Jul 2018 - 09:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ElisabettaVolpi

r2 - 16 Sep 2009 - 22:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ElizabethGeorge

r6 - 16 Oct 2007 - 10:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ElizabethKish

NEW - 21 Jun 2017 - 12:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ElizabethValentine

r3 - 06 Jun 2007 - 08:33

Name: Elizabeth Valentine Email: ev95@columbia.edu Company Name: Columbia University Company URL: http://www.columbia.edu Location: Columbia U ...

EmIP

r39 - 14 Dec 2015 - 17:27

EM Imaging Processing GUI EMIP EMIP is a Graphical User Interface written in wxPython that collects information from the user and runs existing programs from ...

EmilieErnst

NEW - 05 Jun 2024 - 12:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EmilyGrasso

NEW - 26 May 2021 - 10:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EmmaGarst

NEW - 03 Mar 2017 - 15:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EmmanualChang

r3 - 08 Feb 2008 - 23:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EmreFirlar

NEW - 26 May 2011 - 10:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EnjuLima

NEW - 22 Sep 2010 - 12:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EnoEbong

r3 - 19 Aug 2008 - 18:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EricGreene

r2 - 04 Apr 2008 - 16:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EricJurgens

NEW - 16 Oct 2012 - 17:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EricKeeler

r2 - 27 Jan 2022 - 08:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EricRoth

r2 - 11 Mar 2008 - 08:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EricSigmund

NEW - 05 Feb 2008 - 17:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ErickMorgan

NEW - 17 May 2024 - 13:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ErikDebler

r3 - 14 Aug 2007 - 18:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ErikKishTrier

r5 - 05 May 2008 - 08:41

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ErnestoFuentes

r2 - 01 Sep 2009 - 10:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EstherJang

r2 - 08 Jul 2009 - 15:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EthanChen

NEW - 04 Sep 2025 - 10:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EunyongPark

NEW - 03 Aug 2015 - 09:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

EvaVanamee

r2 - 20 Nov 2009 - 12:16

Name: Eva Vanamee Email: eva.vanamee@mssm.edu Company Name: Mount Sinai School of Medicine Company URL: Location: MSSMOffice Country: USA ...

FabianRodriguez

NEW - 18 Jun 2007 - 15:29

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

FabianaRenzi

r16 - 20 Nov 2009 - 12:14

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

FairlandAmos

r2 - 23 Jan 2009 - 07:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FaithVillanueva

NEW - 02 Jun 2011 - 14:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FaizunnaharDewan

NEW - 05 Sep 2018 - 17:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FanrongXiao

r4 - 18 Aug 2008 - 11:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

FatlumHajredini

NEW - 12 Sep 2018 - 17:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FedorSyagin

NEW - 18 Feb 2016 - 15:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FelixWeise

r2 - 09 Feb 2008 - 15:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

FenXu

r2 - 18 Dec 2007 - 18:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FengxiaLiang

r2 - 27 May 2005 - 14:24

Name: Fengxia Liang Email: liangf01@med.nyu.edu Company Name: NYU School of Medicine Company URL: http://saturn.med.nyu.edu Location: NYUSoMOffice ...

FernandoCorrea

NEW - 10 Dec 2014 - 09:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FirazMohideen

r3 - 12 Nov 2009 - 12:15

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

FouadFrancis

NEW - 18 Jun 2007 - 15:10

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

FrancescaGubellini

r2 - 20 Sep 2008 - 11:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FrancineKatz

r3 - 07 Oct 2009 - 16:33

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

FrancisBarany

FrancisBarany

r2 - 14 Aug 2008 - 10:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FrancisPicart

r2 - 22 Jul 2008 - 09:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FranciscoLazaro

FranciscoLazaro

r4 - 22 Sep 2009 - 13:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FrankMacaluso

r4 - 22 Sep 2009 - 10:19

Name: FrankMacaluso Email: frank.macaluso@einstein.yu.edu Company Name: Albert Einstein College of Medicine Company URL: http://www.aecom.yu.edu/aif ...

FraserGlickman

NEW - 09 Aug 2013 - 09:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FredBlanc

r5 - 27 Sep 2008 - 20:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FredMaxfield

r4 - 20 Nov 2009 - 12:47

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

FredNaider

r5 - 05 Oct 2008 - 16:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

FulyaDogan

r2 - 07 Mar 2008 - 10:33

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

GaelMcgill

r5 - 14 Oct 2008 - 11:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GaetanoMontelione

r8 - 27 Sep 2009 - 11:15

Name: Gaetano Montelione Email: guy@cabm.rutgers.edu Company Name: Rutgers University Company URL: http://www.nesg.org Location: SUNY Note location ...

GaliaMaayan

r4 - 15 Dec 2009 - 11:24

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

GaoJ

r3 - 05 May 2008 - 08:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GaohuaLiu

r2 - 23 Jan 2009 - 07:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GarrettKatz

NEW - 28 Jul 2010 - 13:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GaryHowarth

GaryHowarth

r2 - 27 Sep 2016 - 14:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GauravJain

NEW - 02 Jul 2015 - 10:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GautamYadav

NEW - 01 Apr 2015 - 16:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GeoffreyBodenhausen

r2 - 28 Jul 2008 - 17:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GeorgeBennett

r2 - 05 May 2008 - 08:44

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

GeorgeCross

r3 - 29 May 2007 - 13:20

Name: George Cross Email: gamc@mail.rockefeller.edu Company Name: Rockefeller U Company URL: http://www. Location: RockefellerUOffice Country ...

GeorgeDetitta

GeorgeDetitta

NEW - 03 May 2005 - 12:21

Name: GeorgeDetitta Email: detitta@hwi.buffalo.edu Company Name: SUNY Buffalo Company URL: http://www.buffalo.edu Location: SUNYBuffaloOffice ...

GeorgeSukenick

r4 - 10 Aug 2008 - 12:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GeorgeWagner

r6 - 29 Aug 2008 - 11:17

Name: George Wagner Email: george.wagner@us.army.mil Company Name: ECBC Company URL: http://www. Location: ECBC Country: USA Comment ...

GerardLynch

NEW - 12 Nov 2012 - 18:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GethinOwen

r31 - 19 Jan 2010 - 16:05

Name: Gethin Owen Email%: Company Name: NYSBC Company URL: http://www. Location: ParkBuildingOffice Country: USA Comment: CEM lab was ...

GheevargheseRaju

r2 - 31 Jan 2007 - 13:48

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

GiliAbramov

NEW - 21 Mar 2017 - 10:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GillianSmall

GillianSmall

r11 - 03 Mar 2009 - 14:03

Name: Gillian Small Email: Gillian.small@mail.cuny.edu Company Name: CUNY Company URL: http://www.cuny.edu Location: CUNYOffice Address: 535 ...

GiridharSekar

GiridharSekar

r3 - 14 Jun 2016 - 16:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GirishGupta

NEW - 11 Jun 2008 - 10:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GirumAlemu

r3 - 26 Nov 2009 - 12:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GiulianoSciara

r3 - 12 Jan 2010 - 14:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GlendonMcLachlan

GlendonMcLachlan

r3 - 12 Feb 2009 - 12:12

Name: Glendon McLachlan Email: glendon.mclachlan@qc.cuny.edu Company Name: Queens College CUNY Company URL: Location: Queens College Chemistry ...

GlendonMclachlan

NEW - 15 Sep 2011 - 12:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GregAllen

r5 - 20 May 2009 - 13:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GregBoutis

r4 - 13 Sep 2013 - 11:38

Name: Greg Boutis Email: GBoutis@brooklyn.cuny.edu Company Name: Brooklyn College Company URL: http://academic.brooklyn.cuny.edu/physics/boutis/main ...

GregDonald

r2 - 23 Dec 2008 - 13:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GregSiegal

GregSiegal

r2 - 02 May 2008 - 09:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GregoriCaignan

r2 - 12 Sep 2007 - 10:57

Name: Gregori Caignan Email##: caignag@rockefeller.edu % not valid Sep 12, 2007 Company Name: RU Company URL: http://www. Location: RockefellerUOffice ...

GregoryAllen

NEW - 15 Mar 2011 - 18:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GregoryBoel

NEW - 03 Oct 2008 - 14:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GregoryTheophall

r4 - 01 Oct 2025 - 13:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GriseldaHernandez

r2 - 23 Jan 2008 - 16:37

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

GuenterBlobel

r4 - 04 Mar 2008 - 10:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GuidoReuther

r5 - 05 Nov 2008 - 18:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GuobinHu

GuobinHu

r36 - 16 May 2008 - 14:23

Name: Guobin Hu Email: ghu@saturn.med.nyu.edu Company Name: NYUSOM Company URL: http://www. Location: NYUSoMOffice Country: USA Comment ...

GuohongLi

r2 - 30 Jan 2008 - 09:22

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

GuohuaLv

NEW - 16 Jan 2014 - 11:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GuoweiYin

NEW - 02 Mar 2018 - 10:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

GyaneshSharma

NEW - 10 Aug 2009 - 16:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HaijuanYang

NEW - 17 Mar 2015 - 15:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HaitaoLi

HaitaoLi

r3 - 25 Aug 2008 - 12:09

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

HaixiaoGao

HaixiaoGao

NEW - 09 Sep 2005 - 15:47

Name: haixiao Gao Email: hxgao@wadsworth.org Company Name: HHMI Company URL: Location: WadsworthOffice Country: USA Comment: Personal ...

HaixinSui

r3 - 20 Nov 2009 - 12:41

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

HaleyFraser

HaleyFraser

r5 - 12 Apr 2011 - 15:54

My Links My Logbook .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

HangShi

AshleighRaczkowski

r3 - 15 May 2015 - 11:50

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

HannahSteinert

r2 - 28 Jul 2008 - 07:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HansKoss

NEW - 18 Feb 2016 - 11:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HanyingBai

r2 - 28 Jan 2008 - 22:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HaoJiang

r4 - 10 Aug 2008 - 10:35

Name: hao jiang Email : Company Name: city college of new york Company URL: http://www. Location: CUNYCCNYOffice Country: USA Comment ...

HaoWu

r5 - 02 Apr 2009 - 11:08

Name: Hao Wu Email: haowu@med.cornell.edu Company Name: WMCCU Company URL: http://www.med.cornell.edu Location: WMCCU Country: USA Comment ...

HarryKao

r2 - 18 Sep 2008 - 17:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HarryLander

r3 - 04 Feb 2009 - 16:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HarryMaitta

NEW - 03 Sep 2024 - 11:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HelenLu

r2 - 10 Jun 2009 - 17:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HelenTran

r2 - 16 Aug 2013 - 11:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HenanZ

r2 - 06 Aug 2009 - 11:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HenanZhang

HenanZhang

r2 - 26 Aug 2010 - 10:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HernandoJoseSosa

r4 - 19 Nov 2009 - 13:34

Name: HernandoJoseSosa Email: hsosa@aecom.yu.edu Company Name: Albert Einstein College of Medicine Company URL: http://www.aecom.yu.edu Location ...

HildaPasolli

r2 - 30 Jan 2009 - 16:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HildurPalsdottir

HildurPalsdottir

r4 - 16 Oct 2007 - 17:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HiroUryu

HiroUryu

r3 - 12 Oct 2009 - 13:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HiroshiMatsui

r4 - 26 Jul 2007 - 18:58

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

HollyHesterReilly

r3 - 13 Nov 2009 - 13:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HongJi

r2 - 14 Mar 2006 - 14:31

Name: Hong Ji Email: jih@uclink.berkeley.edu Company Name: UC Berkerely Company URL: http://www. Location: (Please specify office location) ...

HongdaHuang

NEW - 03 Mar 2011 - 13:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HongliHu

NEW - 10 Jul 2014 - 15:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HongminLi

HongminLi

r2 - 22 Aug 2008 - 15:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HongningZhou

NEW - 12 Aug 2014 - 10:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HongweiWu

r4 - 05 May 2008 - 08:56

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

HowardYoung

r2 - 07 Nov 2009 - 13:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HsinWang

r4 - 05 May 2008 - 19:24

Name: Hsin Wang Email: hsin.wang@sci.ccny.cuny.edu Company Name: CUNY City College Company URL: Location: CUNYCCNYOffice Country: USA ...

HstauLiao

NEW - 24 Jun 2008 - 09:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HuaHuo

NEW - 05 Mar 2007 - 15:29

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

HuaibinChen

r2 - 28 May 2008 - 15:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HuaibinWang

r4 - 20 Nov 2009 - 12:22

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki ...

HualinZhong

NEW - 06 May 2014 - 12:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HuiShi

NEW - 13 Sep 2011 - 16:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HuihuiKuang

NEW - 09 Sep 2019 - 13:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HuilinLi

NEW - 30 Sep 2010 - 15:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HumairaIlyas

r3 - 04 Aug 2022 - 12:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HunterMoseley

NEW - 19 Mar 2007 - 11:04

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

HuoLeiPeng

NEW - 18 Aug 2011 - 15:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HuwNash

r2 - 15 May 2008 - 14:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

HyukSeo

HyukSeo

NEW - 17 Oct 2005 - 17:03

Name: HyukSeo Email: hseo@rockefeller.edu Company Name: The Rockefeller University Company URL: Location: RockefellerUOffice Country: USA ...

HyukSooSeo

r2 - 02 Apr 2014 - 15:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IanBrett

r2 - 20 May 2008 - 16:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IanGanley

r2 - 12 Dec 2008 - 18:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IanWillis

r3 - 02 Apr 2009 - 11:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IbanUbarretxena

IbanUbarretxena

r44 - 28 Sep 2010 - 12:37

Name: Iban Ubarretxena Email: Iban.Ubarretxena@mssm.edu Company Name: MSSM Company URL: http:// Location: MSSM Country: USA Iban Ubarretxena ...

IgorDikiy

IgorDikiy

r5 - 20 Oct 2025 - 12:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IlanJenLaPlante

IlanJenLaPlante

r2 - 22 Apr 2014 - 09:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IlanaKarp

IlanaKarp

r2 - 08 Jun 2017 - 14:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IlonaNudelman

IlonaNudelman

r2 - 24 May 2011 - 18:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IlwonKim

r4 - 13 Mar 2009 - 11:33

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ImaneDjemil

r2 - 10 May 2007 - 10:03

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ImranKhan

NEW - 06 Oct 2023 - 15:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

InfotechUser

r2 - 14 Jan 2009 - 15:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IngridHahn

r4 - 12 Nov 2009 - 12:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

InnaGrosheva

r2 - 08 May 2008 - 14:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IoannisGelis

r3 - 22 Dec 2009 - 12:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IreneRostovsky

NEW - 05 Feb 2019 - 13:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IritKatash

r2 - 17 Sep 2008 - 16:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IrvingRosario

NEW - 08 Mar 2021 - 09:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ItzhakGoldberg

NEW - 15 Aug 2007 - 17:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ItzhakMano

r2 - 30 Dec 2009 - 08:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IvaPerovic

NEW - 19 Apr 2012 - 09:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IvanRazinkov

NEW - 04 Feb 2015 - 17:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IvanRiveraTorres

r2 - 22 Apr 2009 - 23:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IvanSergeyev

r2 - 31 Jan 2008 - 21:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IvanoBertini

r3 - 02 Aug 2010 - 12:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

IvayloMadzharov

IvayloMadzharov

r2 - 27 Apr 2010 - 16:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JackFreed

JackFreed

NEW - 14 Mar 2006 - 09:52

Name: Jack Freed Email: jkt27@cornell.edu Company Name: Cornell U Company URL: http://www. Location: (Please specify office location) Country ...

JackRosenbluth

r3 - 20 Nov 2009 - 12:20

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

JaclynGreimann

NEW - 19 Sep 2006 - 11:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JaclynNovatt

JaclynNovatt

NEW - 09 Sep 2005 - 17:20

Name: Jaclyn Novatt Email: novattj@mail.rockefeller.edu Company Name: The Rockefeller University Company URL: http://www. Location: RockefellerUOffice ...

JacobBanik

r3 - 05 Jun 2008 - 23:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JacobNewman

NEW - 15 Nov 2006 - 13:14

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JacobWeaver

NEW - 18 Mar 2015 - 12:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JacopoSamson

NEW - 25 Jan 2007 - 12:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JaehyunCho

r2 - 16 Jan 2007 - 12:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JaimeLlodra

r3 - 04 Sep 2008 - 12:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JakeRiley

r3 - 03 Jun 2008 - 08:16

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JamesAramini

NEW - 20 Mar 2007 - 09:15

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JamesBanigan

r3 - 21 Apr 2016 - 09:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JamesGordon

r5 - 12 Jan 2009 - 11:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JamesKempf

r22 - 05 Dec 2009 - 15:10

Personal Preferences Uncomment preferences variables to activate them (remove the # sign). Help and details on preferences variables are available in .. Show ...

JamesLetts

r2 - 17 Mar 2010 - 16:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JamesLove

r10 - 12 Jan 2010 - 14:09

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

JamesManley

r3 - 08 May 2008 - 13:11

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JamesMartin93

NEW - 30 Aug 2019 - 15:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JamesMcDonnell

r7 - 29 Jan 2010 - 13:11

Name: James McDonnell Email: james.mcdonnell@kcl.ac.uk Company Name: KCL London ex U Oxford Company URL: Location: (Please specify office location ...

JamesMunro

JamesMunro

NEW - 14 Sep 2005 - 18:53

Name: James Munro Email: jbm2002@med.cornell.edu Company Name: Weill Medical College of Cornell University Company URL: Location: WMCCUOffice ...

JamesPrestegard

r4 - 29 May 2007 - 13:23

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JamesRothman

r6 - 17 Apr 2009 - 13:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JamesThompson

r2 - 28 Apr 2010 - 16:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JamesWeyhenmeyer

r3 - 22 Jan 2009 - 22:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JanetHuang

r2 - 08 Feb 2008 - 23:16

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JaniSeitsonen

JaniSeitsonen

r2 - 09 Aug 2013 - 09:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JanicePata

JanicePata

NEW - 13 Sep 2005 - 10:52

Name: Janice Pata Email: jpata@wadsworth.org Company Name: Wadsworth Center Company URL: http://www.wadsworth.org/resnres/bios/pata.htm Location ...

JannetteRondo

JannetteRondo

r3 - 12 Jul 2007 - 11:09

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

JaredSampson

NEW - 02 Jun 2011 - 12:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JasminJakob

NEW - 28 Mar 2011 - 06:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JasonMuller

r3 - 25 Nov 2008 - 19:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JasperShahn

r49 - 19 Jan 2010 - 16:05

Name: Jasper Shahn Email%: Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Phone: 1 212 939 0660 x 9102 ...

JavierColoma

NEW - 31 May 2011 - 16:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JayFlatt

r3 - 09 Apr 2010 - 13:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JayJung

r4 - 19 Jan 2010 - 16:04

Name: Jay Jung Email%: Company Name: SUNY SB Company URL: http://www. Location: SUNYSBOffice Country: USA Comment: default on endorsement ...

JayTepp

NEW - 14 Aug 2019 - 17:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JayantJayasundar

NEW - 16 Aug 2010 - 12:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeetayuBiswas

NEW - 18 Feb 2016 - 17:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeffreyBonanno

r8 - 21 Mar 2008 - 18:09

Name: Jeffrey Bonanno Email: jeffbonanno@yahoo.com Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country ...

JeffreyCraig

r2 - 15 Jun 2008 - 11:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeffreyHoch

r5 - 09 Jul 2008 - 17:04

Name: Jeffrey Hoch Email: hoch@uchc.edu Company Name: U CT Health Center Company URL: http://structbio.uchc.edu/HochLab files/index.html Location ...

JeffreyMills

r2 - 22 Apr 2009 - 23:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeffreyRice

r2 - 01 Aug 2007 - 08:46

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

JeffreyWCraig

r2 - 18 Sep 2008 - 17:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeffreyZapfe

r2 - 25 Jul 2008 - 12:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JenZenChuang

r5 - 16 Jan 2015 - 11:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JenniferWilliamson

NEW - 18 May 2017 - 16:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeremyDittman

r2 - 18 Dec 2013 - 12:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeremyNance

r2 - 20 May 2009 - 14:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JeremyPaul

JeremyPaul

r4 - 15 Nov 2008 - 08:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JerryGuyden

r3 - 02 Oct 2009 - 12:31

Name: Jerry Guyden Email: jerry@sci.ccny.cuny.edu Company Name: CCNY Company URL: http://www.ccny.cuny.edu Location: CUNYOffice Country ...

JeskoKoehnke

r2 - 07 Mar 2008 - 22:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JesperPallesen

r2 - 10 Sep 2008 - 06:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JesseGelles

NEW - 14 Jun 2022 - 14:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JesseHauver

NEW - 18 Jan 2012 - 16:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JesseMcCann

NEW - 03 Sep 2013 - 09:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JessicaFreyer

JessicaFreyer

r2 - 03 Oct 2014 - 16:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet CemProposalJessicaFreyer07091440 ...

JessicaNorman

r2 - 19 Dec 2007 - 13:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JiSun

NEW - 03 Aug 2015 - 11:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JiaWei

r2 - 07 Sep 2012 - 13:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JiajunWu

NEW - 18 Jan 2016 - 13:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JianYang

r2 - 06 Dec 2007 - 18:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JianpingLi

NEW - 17 Oct 2018 - 18:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JianqinZhuang

NEW - 08 Sep 2011 - 12:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JieFan

r5 - 25 Feb 2014 - 12:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JieFu

r4 - 23 Jun 2008 - 11:03

Name: Jie Fu Email: jf2528@columbia.edu Company Name: Columbia Company URL: Location: ColumbiaMedCenterOffice Country: USA Comment: ...

JieZheng

JieZheng

r6 - 09 Oct 2008 - 10:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JikuiSong

r5 - 11 Apr 2008 - 18:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JinChai

r3 - 08 Dec 2008 - 11:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JinGao

r3 - 09 Apr 2008 - 17:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JinWu

NEW - 17 Nov 2011 - 15:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JingWang

NEW - 24 Jan 2018 - 14:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JingchuanSun

NEW - 20 Mar 2011 - 21:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JinghongMa

JinghongMa

r4 - 06 Oct 2008 - 11:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JingqiDuan

NEW - 27 Aug 2013 - 19:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JinrangKim

JinrangKim

r4 - 19 May 2011 - 11:44

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JixiLi

NEW - 13 Sep 2011 - 20:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoachimFrank

r13 - 21 Jan 2010 - 14:33

Name: Joachim Frank Email: tb2319@columbia.edu Company Name: Columbia Office Company URL: Location: ColumbiaMedCenterOffice Country: USA ...

JoannaGiza

NEW - 21 Aug 2013 - 11:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JochemStruppe

NEW - 01 Nov 2010 - 14:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoeEichenbaum

r2 - 27 Oct 2008 - 10:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoeJaeger

JoeJaeger

NEW - 10 Sep 2005 - 04:39

Name: Joe Jaeger Email: jj@wadsworth.org Company Name: Wadsworth CMS Company URL: http://www.wadsworth.org/resnres/bios/jaeger.htm Location: WadsworthOffice ...

JoeManiscalco

r2 - 08 Jun 2009 - 17:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoekeemArizala

NEW - 07 Sep 2018 - 11:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoelBelasco

r2 - 12 Nov 2008 - 07:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoelButterwick

r9 - 01 Jun 2009 - 11:03

Name: Joel Butterwick Email: jbutterwic@mail.rockefeller.edu Location: RockefellerUOffice Personal Preferences (details in .TWikiVariables) Horizontal ...

JoelHirsch

NEW - 03 Sep 2014 - 11:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoelSandler

r11 - 21 Jul 2010 - 16:25

Name: JoelSandler Email%%: jsandler at mail.rockefeller.edu Company Name: Company URL: http://www. Location: RockefellerUOffice Country: USA ...

JoelSilverman

r7 - 30 Jul 2007 - 16:44

Name: Joel Silverman Email%: Company Name: Silverman Assoc. Country: USA Comment: Placeholder for reference. Maintained by DavidCowburn / staff ...

JoelTang

NEW - 19 Nov 2008 - 09:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohannaNapetschnig

JohannaNapetschnig

NEW - 11 Sep 2005 - 11:58

Name: Johanna Napetschnig Email: jnapetschn@mail.rockefeller.edu Company Name: The Rockefeller University Company URL: http://www.rockefeller.edu ...

JohnAitchison

r2 - 22 Apr 2008 - 22:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnAlexopoulos

NEW - 31 Oct 2013 - 12:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnAllen

JohnAllen

r3 - 24 Oct 2007 - 17:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnBauer

r3 - 30 Jun 2010 - 18:09

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JohnBerriman

r5 - 30 Jan 2009 - 16:40

Name: John Berriman Email: jberrim@nimr.mrc.ac.uk Company Name: Company URL: Location: Other Country: UK Comment: Personal Preferences ...

JohnBushweller

r3 - 24 Sep 2009 - 19:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnCondeelis

NEW - 15 May 2008 - 16:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnDecatur

r4 - 02 Jun 2006 - 09:43

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

JohnEvans

r2 - 02 Jun 2008 - 10:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JohnHunt

r10 - 09 Sep 2008 - 09:25

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JohnK

NEW - 14 Mar 2019 - 11:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnKoss

r3 - 12 Dec 2008 - 18:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnKulp

JohnKulp

NEW - 28 Mar 2005 - 11:50

Name: John Kulp Email: jlk287@nyu.edu Company Name: NYU Company URL: http://www.nyu.edu Location: NYUOffice Country: USA Comment: ...

JohnMaciejowski

r3 - 10 Sep 2013 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet CemEngProjects Personal Preferences ...

JohnMagyar

r2 - 28 Aug 2009 - 14:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JohnPalumbo

r4 - 07 Oct 2008 - 17:28

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

JohnSchwanof

JohnSchwanof

r4 - 16 May 2008 - 11:51

Name: John Schwanof Email: schwanof@bnl.gov Company Name: Company URL: Location: BNLOffice Country: USA Comment: Personal Preferences ...

JonHoughton

r5 - 01 Dec 2009 - 09:32

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JonLee

JonLee

r3 - 06 Jan 2014 - 18:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JonahCheung

NEW - 22 Nov 2010 - 13:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JonathanBacker

r4 - 02 Apr 2009 - 09:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JonathanGoldberg

r2 - 11 Oct 2007 - 16:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JonathanKim

NEW - 01 Dec 2015 - 11:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JonathanLai

r2 - 16 Jun 2014 - 12:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JonathanLevitt

NEW - 16 Oct 2014 - 15:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JonathanPreston

NEW - 10 Jun 2019 - 13:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JongsikKim

NEW - 31 Oct 2008 - 12:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JorgeJose

r3 - 12 Dec 2007 - 10:21

Name: Jorge Jose Email %% : Company Name: Buffalo Company URL: http://www. Location: SUNYBuffaloOffice Country: USA Comment: Filled ...

JorgeMansillaSoto

r5 - 20 Nov 2009 - 12:00

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

JorgeMorales

r3 - 05 Nov 2007 - 17:05

Name: Jorge Morales Email: morales@sci.ccny.cuny.edu Company Name: ccny Company URL: ccny, Marshak, J519 Location: CUNYCCNYOffice Country ...

JoseChavez

r2 - 05 Oct 2009 - 11:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoseMartinez

NEW - 10 Dec 2014 - 14:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JosefFranke

r8 - 07 Dec 2009 - 12:48

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

JosephGoncalves

r2 - 30 Apr 2008 - 15:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JosephKielec

r2 - 19 Feb 2008 - 09:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JosephLidestri

JosephLidestri

r3 - 14 May 2013 - 19:35

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

JosephMeisel

NEW - 30 Jan 2019 - 15:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JosephSall

NEW - 22 Feb 2018 - 11:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoshGuterrez

NEW - 31 Oct 2018 - 14:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoshuaCooksey

NEW - 16 Jun 2025 - 16:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoshuaGoldman

r3 - 02 Nov 2007 - 12:34

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JoshuaGuterrez

NEW - 31 Oct 2018 - 13:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoshuaGutierrez

NEW - 14 Nov 2018 - 17:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoshuaKhoo

NEW - 14 Oct 2015 - 08:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JoshuaStrauss

JoshuaStrauss

NEW - 14 Sep 2005 - 09:27

Name: joshua strauss Email: jds05@health.state.ny.us Company Name: University at Albany Company URL: Location: WadsworthOffice Country: USA ...

JoshuaWand

r4 - 31 Oct 2007 - 14:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JuYang

NEW - 06 Jul 2015 - 12:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JuliaBrasch

NEW - 03 Nov 2015 - 11:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JuliaHestenes

NEW - 06 Feb 2020 - 00:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JuliaOktawiec

r2 - 08 Jul 2009 - 15:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JulianaAgudelo

NEW - 25 Jul 2013 - 10:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JulienGros

NEW - 08 Aug 2012 - 07:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JuliyaKalinina

r2 - 13 Dec 2006 - 10:35

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JunMa

NEW - 12 Sep 2006 - 15:04

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

JunRice

NEW - 09 Sep 2010 - 12:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JunWu

r2 - 23 Sep 2009 - 14:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JungSong

JungSong

NEW - 09 Sep 2005 - 12:21

Name: Jung Song Email: jhsong@chemail.engr.ccny.cuny.edu Company Name: Graduate Center of CUNY Company URL: http://www1.ccny.cuny.edu/prospective/engineering ...

JungeunPark

NEW - 21 May 2019 - 16:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JunyanZhong

r3 - 29 Sep 2008 - 00:46

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

JustinLorieau

r2 - 11 Aug 2005 - 09:41

Name: Justin Lorieau Email: jll2006@columbia.edu Company Name: Columbia U Company URL: http://lungo.chem.columbia.edu Location: ColumbiaUOffice ...

JustinWilliams

JustinWilliams

r2 - 26 Feb 2020 - 15:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

JustinaChinwong

NEW - 17 Oct 2011 - 10:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KakoliMitra

r5 - 22 Apr 2009 - 00:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KanNianHu

r3 - 09 Jul 2008 - 16:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

KandalChary

NEW - 05 Sep 2008 - 09:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KanishkKapilashrami

KanishkKapilashrami

r4 - 23 Jun 2009 - 10:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KarinBlock

NEW - 24 Sep 2012 - 14:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KartikPilar

NEW - 17 Sep 2013 - 10:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KashyapMaruthi

NEW - 19 Aug 2019 - 17:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KateLeitch

r2 - 15 Sep 2009 - 09:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KateStafford

r2 - 20 Oct 2009 - 23:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KatherineEyring

NEW - 16 Mar 2015 - 18:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KathleenMcGreevy

r2 - 09 Jul 2009 - 22:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KathleenPickering

r2 - 03 May 2010 - 11:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KatieFeher

NEW - 19 Sep 2013 - 20:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KatrinaCaroccia

NEW - 18 Oct 2010 - 14:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KatyaDelak

r2 - 15 Jan 2008 - 16:20

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

KaushikDutta

KaushikDutta

r15 - 19 Apr 2010 - 16:11

Name: Kaushik Dutta Login Name: kdutta Email: dutta@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice ...

KawingKarenLo

NEW - 09 Sep 2010 - 11:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KdDerr

r134 - 19 Dec 2012 - 16:38

Name: KD Derr Email: kderr@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Serial EM Support Resources ...

KehuiXiang

NEW - 29 Jun 2012 - 12:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KeithFritzsching

NEW - 19 Mar 2018 - 16:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KeithHamilton

NEW - 25 Sep 2014 - 15:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KeithNorris

r3 - 28 Mar 2008 - 02:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KellieMorgan

NEW - 18 Jul 2008 - 11:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KellyGreenland

KellyGreenland

r2 - 29 Jan 2015 - 16:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KellyJamieson

KellyJamieson

NEW - 05 Oct 2005 - 07:51

Name: Kelly Jamieson Email: kvj202@med.nyu.edu Company Name: NYUSOM Company URL: Location: NYUSoMOffice Country: USA Comment: Personal ...

KelseyJordan

NEW - 01 Dec 2015 - 11:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KelseyMcCoy

NEW - 18 Feb 2016 - 11:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KenConover

r2 - 28 Aug 2008 - 20:57

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

KenMcGuinness

NEW - 17 Sep 2013 - 18:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KenNguyen

r3 - 07 Jul 2010 - 10:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KennethMarians

r5 - 29 Aug 2008 - 13:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KennethMcGuinness

NEW - 29 Oct 2013 - 13:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KentKirshenbaum

r2 - 02 Jun 2009 - 13:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KerryGoodman

NEW - 05 Feb 2013 - 10:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KevinBattaile

NEW - 13 Aug 2019 - 11:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KevinDAmico

r2 - 12 Dec 2008 - 00:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KevinDalby

r6 - 19 Nov 2008 - 12:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KevinGardner

r4 - 21 Apr 2016 - 09:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KeyvanDastmalchi

NEW - 16 Apr 2012 - 16:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KhurshidaShahidulah

r2 - 22 Jan 2010 - 17:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KhurshidaShahidullah

r4 - 09 Nov 2010 - 15:33

My Logbook Patrick Barre's Project proposal My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet ...

KirkBaughman

NEW - 24 Nov 2021 - 11:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KoheiNagahata

NEW - 21 Jun 2007 - 14:13

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

KotaroKelley

NEW - 21 Nov 2017 - 11:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KrestenLindorffLarsen

r2 - 18 Mar 2008 - 19:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KristenDancel

KristenDancel

r3 - 20 Jun 2014 - 12:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KristianSchweimer

r5 - 12 Nov 2008 - 13:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KristinPoliti

r2 - 05 Jan 2009 - 14:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KumikoSugawara

r5 - 13 Sep 2008 - 21:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KunWeiChan

NEW - 16 Sep 2011 - 11:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KunalChaudhary

YuehawKhoo

r2 - 05 Dec 2011 - 10:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KuoChiangHsia

r3 - 09 Jan 2012 - 16:49

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

KuoYingHuang

r2 - 22 Jan 2008 - 17:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

KyengLee

KyengLee

r3 - 05 Oct 2007 - 12:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LakshmiBhai

NEW - 12 Mar 2025 - 15:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LamourV

r3 - 19 Jan 2010 - 16:02

Name: Valerie Lamour Email%: Company Name: The Rockefeller University Company URL: http://www.rockefeller.edu Location: RockefellerUOffice ...

LanceSilverman

LanceSilverman

r2 - 11 Jul 2009 - 20:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LaneGilchrist

LaneGilchrist

r5 - 26 Oct 2014 - 21:15

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LarryBrathworth

r2 - 25 Aug 2009 - 12:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LarsBranden

r2 - 20 Feb 2007 - 16:39

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

LauraBarreyro

r2 - 15 Aug 2008 - 09:31

Name: Laura Barreyro Email SUSPENDED BOX FULL NO REPSONSE : barreyro@sci.ccny.cuny.edu Company Name: The City college of New York Company URL: http ...

LauraKim

LauraKim

r2 - 22 Jul 2019 - 14:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LaurenMarbella

NEW - 16 Oct 2018 - 12:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LaurenODonnell

NEW - 18 Oct 2019 - 10:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LaurentBochereau

r2 - 16 Feb 2009 - 14:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LawrenceShapiro

r8 - 29 Jan 2010 - 15:02

Name: Lawrence Shapiro Email: shapiro@convex.hhmi.columbia.edu Company Name: Columbia U P S Company URL: http://www.columbia.edu Location: ColumbiaMedCenterOffice ...

LeahCohen

r2 - 29 May 2007 - 17:02

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LeandroLemgruber

NEW - 08 Mar 2013 - 14:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LeeArnold

r3 - 18 Jun 2010 - 11:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LeeCohenGould

r2 - 08 May 2008 - 14:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LeiHuang

r2 - 23 Jan 2008 - 16:40

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LeiZeng

r2 - 10 May 2007 - 10:05

Name: lei zeng Email: lei.zeng@mssm.edu Company Name: MSSM Company URL: Location: MSSMOffice Country: USA Comment: Personal Preferences ...

LeiZhang

r4 - 11 Mar 2008 - 15:01

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LenzieFord

NEW - 03 Nov 2015 - 11:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LenzieHarcum

NEW - 16 May 2007 - 19:18

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LesleyHolmes

r4 - 02 Nov 2009 - 12:43

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LeslieCummins

LeslieCummins

NEW - 13 Sep 2005 - 10:54

Name: Leslie Cummins Email: gunther@aecom.yu.edu Company Name: AECOM Company URL: Location: (Please specify office location) Country: USA ...

LeszekKotula

NEW - 06 Mar 2008 - 13:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiWang

NEW - 25 Mar 2014 - 11:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiZhu

NEW - 25 Mar 2014 - 13:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiangTong

r2 - 20 Aug 2007 - 21:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LihuaSong

NEW - 06 Aug 2013 - 10:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LilaIinoRubenstein

r3 - 18 Dec 2008 - 12:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiliHuang

r2 - 02 Dec 2008 - 11:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiliWang

NEW - 07 Nov 2013 - 11:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LilySun

r2 - 21 May 2010 - 15:16

My User Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

LimingYin

r4 - 12 Sep 2013 - 16:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LinTang

LinTang

r2 - 29 Apr 2013 - 20:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LinTian

r2 - 04 Jan 2008 - 10:50

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LindaJelicks

r2 - 14 Oct 2008 - 14:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LindsayTurner

NEW - 10 Jul 2008 - 15:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LinnaeaOstroff

NEW - 11 Oct 2011 - 12:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiqingJin

NEW - 10 Jan 2014 - 16:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LisaGreen

r2 - 19 Sep 2009 - 15:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LisaKennedy

NEW - 27 Oct 2008 - 11:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LiweiWang

r2 - 17 Sep 2008 - 16:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LizMiller

NEW - 19 Apr 2012 - 13:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LizhengZhu

NEW - 12 Dec 2012 - 15:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LongxiZhao

LongxiZhao

r2 - 31 Mar 2014 - 14:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LorenHough

r4 - 20 Nov 2009 - 12:36

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

LoriFortunato

r2 - 12 Nov 2008 - 10:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LorraineBrocato

NEW - 18 Apr 2007 - 15:41

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

LorraineCavanaugh

r5 - 10 Apr 2009 - 10:39

Name: Lorraine Cavanaugh Email%: Company Name: Columbia University Company URL: http://www.columbia.edu/cu/biology Location: ColumbiaUOffice ...

LorraineLeon

NEW - 16 Sep 2008 - 10:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LouVitale

r11 - 01 Nov 2007 - 13:58

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

LouisLevinger

r3 - 25 Jun 2009 - 12:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LouisMartillotti

r6 - 14 Sep 2009 - 12:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LucasOliveira

NEW - 17 Apr 2013 - 12:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LucianoMueller

r2 - 19 Dec 2007 - 13:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LucienneBuannic

r2 - 16 Oct 2008 - 17:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LudovicRenault

r3 - 27 Nov 2009 - 17:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LuisCunha

r2 - 24 Sep 2009 - 22:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LumingPeng

r3 - 10 Aug 2008 - 10:42

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

LuonaAnjia

r3 - 20 Oct 2009 - 14:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

LynnMcNaughton

r5 - 30 Nov 2009 - 13:29

Name: Lynn McNaughton Email%: mcnaugh at wadsworth.org Company Name: Wadsworth Center Company URL: Location: WadsworthOffice Country: USA ...

MagaliCottevieille

MagaliCottevieille

r4 - 19 Nov 2008 - 16:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MahiuddinAhmed

r2 - 08 Mar 2006 - 17:29

Name: Mahiuddin Ahmed Email: mahiuddin.ahmed@stonybrook.edu Company Name: SUNY SB Company URL: http://www. Location: SUNCYSBOffice Country ...

MakonnenPayne

MakonnenPayne

NEW - 28 Sep 2005 - 17:29

Name: Makonnen Payne Email: payne@chs2s0.engr.ccny.cuny.edu Company Name: City College of New York Company URL: Location: CUNYCCNYOffice ...

MalaKishore

NEW - 12 Aug 2008 - 11:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MalanSilva

MalanSilva

r2 - 11 Dec 2012 - 22:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MalikChakerMargot

MalikChakerMargot

r2 - 03 Nov 2014 - 16:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MallikaSastry

r2 - 13 Sep 2011 - 12:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MalloryGobet

MalloryGobet

r3 - 01 Jun 2017 - 14:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ManasiBhate

r8 - 10 Sep 2010 - 15:55

My Links My User Logbook .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

ManijehMohraz

r2 - 16 Oct 2007 - 11:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ManishSingh

NEW - 30 Jan 2007 - 16:36

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ManjulaDeviKolipaka

RuthStark

r4 - 24 Apr 2008 - 13:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ManolisPahakis

ManolisPahakis

NEW - 09 Sep 2005 - 11:52

Name: Manolis Pahakis Email: ninemia@yahoo.com Company Name: Graduate Center CUNY (City College) Company URL: http://bme.ccny.cuny.edu/ Location ...

MarcAllaire

r3 - 09 Sep 2009 - 13:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarcWalters

r2 - 16 Jul 2009 - 15:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarcoCeruso

r3 - 09 Jan 2009 - 12:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarcusFislage

MarcusFislage

r2 - 02 Mar 2016 - 14:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MargieMendoza

r2 - 09 Apr 2010 - 18:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MariaLuisaLopezRedondo

NEW - 03 Jun 2013 - 11:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MariaLuisaLopezredondo

NEW - 19 Sep 2011 - 11:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MariaLuisaTasayco

r4 - 19 Jan 2010 - 16:05

Name: Maria Luisa Tasayco Email%: Company Name: City College of New York Company URL: Location: CUNYCCNYOffice Country: USA Comment ...

MariaTeresaCatanese

r2 - 31 May 2011 - 11:22

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

MaribelVazquez

r2 - 07 Feb 2008 - 13:19

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MarieSweet

NEW - 02 Jul 2015 - 09:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarienaSilvestry

r7 - 17 Apr 2012 - 15:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarilynGunner

r2 - 27 Apr 2007 - 20:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MarinaYoffe

NEW - 03 Jun 2013 - 13:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarioPujato

r3 - 30 Jul 2007 - 17:07

Name: Mario Pujato Email: mpujato@aecom.yu.edu Company Name: AECOM Company URL: Location: (Please specify office location) Country: USA ...

MarkArbing

r4 - 29 Aug 2008 - 13:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MarkGirvin

MarkGirvin

r16 - 12 Mar 2014 - 14:26

Name: Mark Girvin Email: mark.girvin@einstein.yu.edu Company Name: Albert Einstein College of Medicine Company URL: http://www.bioc.aecom.yu.edu/labs ...

MarkLukin

r2 - 24 Feb 2008 - 16:06

Name: Mark Lukin Email: lukin@pharm.stonybrook.edu Company Name: SUNY at Stony Brook Company URL: Location: SUNYSB Country: USA Comment ...

MarkusSeeliger

r2 - 13 Sep 2010 - 09:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarleneOeffinger

NEW - 14 Jan 2009 - 17:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MartaFilizola

MartaFilizola

r2 - 02 Aug 2013 - 17:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MartaValens

r2 - 30 Jan 2009 - 16:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MarthaMcGilvray

r3 - 14 Oct 2008 - 12:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MartinKampmann

r3 - 20 Nov 2009 - 12:35

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

MartinNausner

r2 - 15 Jan 2009 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MartinPendola

NEW - 07 Jul 2017 - 09:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MartinVink

MartinVink

r95 - 12 Feb 2010 - 16:05

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

MartineZiliox

r2 - 05 Dec 2005 - 06:54

Name: Martine Ziliox Email: martine.ziliox@sunysb.edu Company Name: Stony Brook University Company URL: http://www.csb.sunysb.edu Location: SUNYSBOffice ...

MaryAlpaugh

r2 - 18 Jun 2010 - 12:48

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

MaryBaylies

r4 - 02 Apr 2009 - 09:51

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MaryHeavner

MaryHeavner

r2 - 08 Jul 2014 - 17:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet TWiki pages of interest CemProposalMaryHeavner07081418 ...

MathewVetticatt

r2 - 12 Mar 2010 - 14:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MatousekW

NEW - 11 Jul 2007 - 14:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

MattWhorton

r2 - 12 Dec 2008 - 00:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MatteoPorotto

NEW - 24 Aug 2011 - 10:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MatthewCraddock

MatthewCraddock

NEW - 26 Sep 2005 - 16:12

Name: matthew craddock Email: mc2599@columbia.edu Company Name: Columbia University Company URL: http://lungo.chem.columbia.edu/ Location: ColumbiaUOffice ...

MatthewDevany

NEW - 12 Dec 2012 - 15:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MatthewFranklin

NEW - 20 Oct 2010 - 12:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MatthewNicholas

MatthewNicholas

r12 - 14 Apr 2009 - 14:12

Name: Matthew Nicholas Email: mnichola@aecom.yu.edu Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country ...

MaureenLeninger

NEW - 15 Jan 2015 - 14:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MaxGottesman

r2 - 05 Mar 2008 - 17:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MayPohLai

NEW - 30 Jan 2015 - 11:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MayuTerakawa

NEW - 18 Jan 2016 - 13:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MayurSharma

NEW - 06 Jan 2014 - 12:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MeganShaw

r5 - 20 Nov 2009 - 11:57

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

MeigangGu

NEW - 23 Jul 2007 - 10:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MelodyCampbell

NEW - 03 Aug 2015 - 11:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MengJiang

r3 - 02 Nov 2009 - 12:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MiaBrown

NEW - 18 Jan 2016 - 11:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelAndrec

NEW - 10 Jan 2008 - 12:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelAppel

r2 - 03 Sep 2009 - 16:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelCampos

NEW - 27 Mar 2014 - 16:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelCassidy

r3 - 16 Oct 2009 - 15:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelDeLay

MichaelDeLay

r2 - 07 May 2014 - 12:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelDustin

NEW - 09 Jan 2012 - 10:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelEGreen

NEW - 06 Dec 2006 - 11:36

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MichaelGoger

r7 - 19 Nov 2010 - 16:25

Name: Michael Goger Email: gogerm@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country ...

MichaelHarris

r2 - 13 Dec 2006 - 12:36

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MichaelHodsdon

MichaelHodsdon

NEW - 09 Mar 2006 - 12:25

Name: Michael Hodsdon Email: michael.hodsdon@yale.edu Company Name: Yale U Company URL: http://www. Location: (Please specify office location) ...

MichaelLandsberg

r3 - 24 Jul 2009 - 12:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelLinden

r2 - 07 Jan 2008 - 09:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MichaelMalkowski

MichaelMalkowski

r2 - 10 Jul 2013 - 13:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelMurphy

NEW - 24 Nov 2020 - 10:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelMurphy2

NEW - 24 Nov 2020 - 10:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelOsborne

r3 - 09 Jul 2008 - 17:10

Name: Michael Osborne Email: michael.osborne@umontreal.ca Company Name: IRIC University of Montreal Company URL: www.iric.ca Location: UMontreal ...

MichaelOverduin

r3 - 10 May 2007 - 14:28

Name: Michael Overduin Email: m.overduin@bham.ac.uk Company Name: U Birmingham Company URL: Location: (Please specify office location) ...

MichaelPhelps

MichaelPhelps

r2 - 17 Nov 2009 - 09:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelRout

r6 - 27 Jan 2010 - 16:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelRudolph

NEW - 01 Dec 2011 - 17:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelSheetz

r2 - 03 Apr 2009 - 12:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelStaropoli

r6 - 31 Jul 2008 - 09:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichaelSummers

r3 - 25 Jun 2008 - 12:23

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MichaelWard

r4 - 30 Sep 2008 - 21:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichalKruk

r2 - 06 Nov 2007 - 11:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MichelleGill

r3 - 19 Oct 2009 - 14:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MiguelGarciaDiaz

MiguelGarciaDiaz

r2 - 07 Dec 2007 - 11:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MihaiCucuringu

MihaiCucuringu

r3 - 17 Nov 2008 - 21:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MikeBucaro

NEW - 04 Oct 2012 - 13:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MikeMarko

MikeMarko

r3 - 09 Sep 2017 - 23:16

Name: Mike Marko Email: mike.marko.em@gmail.com Company Name: Wadsworth Company URL: https://www.wadsworth.org/research/cores/3d em Location: WadsworthOffice ...

MikiItaya

r2 - 28 Nov 2007 - 13:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MilenaPopovic

MilenaPopovic

r5 - 15 Dec 2011 - 12:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MiloRussell

NEW - 22 Oct 2013 - 15:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MiltonWerner

r7 - 12 Jan 2009 - 15:59

Name: Milton Werner Email old: mwerner at portugal.rockefeller.edu Company Name: Rockefeller University Company URL: http://www.rockefeller.edu ...

MinKyuCho

NEW - 22 Oct 2012 - 19:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MinLu

r5 - 30 Oct 2009 - 14:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MingMingZhou

r11 - 08 Apr 2009 - 12:00

Name: Ming Ming Zhou Email: ming ming.zhou@mssm.edu Company Name: MSSM Company URL: http://www.mssm.edu Location: MSSM Phone 212 659 8652 ...

MingSun

MingSun

r2 - 12 Sep 2012 - 08:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MingTang

NEW - 17 Jun 2013 - 10:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MingZhou

r3 - 09 Apr 2009 - 07:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MinghuiHu

MinghuiHu

r6 - 12 Nov 2009 - 18:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MinghuiLi

r2 - 05 May 2015 - 11:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MinhChauNguyen

NEW - 04 Sep 2025 - 09:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MiquelVilaPerello

r2 - 21 Apr 2009 - 18:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MiriamWodrich

r2 - 18 Sep 2012 - 15:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MirjamHunziker

MirjamHunziker

r4 - 20 Dec 2014 - 22:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MohammadAhsan

r2 - 16 Oct 2008 - 09:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MohammedBhuiyan

SebastienPoget

r2 - 27 Jul 2011 - 13:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MoiseNdao

r2 - 23 Jan 2009 - 07:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MonikaRaj

NEW - 17 Aug 2011 - 13:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MoosaMohammadi

r8 - 01 Apr 2010 - 12:04

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

MoraisBrown

NEW - 14 Nov 2017 - 12:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MouneshaGaraga

NEW - 14 Jan 2019 - 15:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MoyouriBhattacharjee

NEW - 09 Sep 2010 - 11:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MuniaMukherjee

r5 - 13 Mar 2009 - 11:35

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

MurkinA

MurkinA

r3 - 30 Mar 2010 - 13:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MyaThandar

NEW - 18 Sep 2013 - 09:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MyungKo

NEW - 28 Mar 2022 - 17:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

MyungSooKo

NEW - 20 Oct 2021 - 08:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NadiaSeverina

r2 - 15 Sep 2009 - 16:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NadineSoplop

NEW - 08 Mar 2013 - 14:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NadrianSeeman

r5 - 17 Jan 2008 - 16:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NagarajRao

NEW - 18 May 2007 - 17:45

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NaiKongCheung

r2 - 23 Dec 2009 - 22:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NancyGoroff

NEW - 29 Mar 2007 - 09:50

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NancyGreenbaum

r6 - 03 Sep 2008 - 16:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NancyHom

r3 - 31 May 2011 - 10:25

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

NancyMedina

NEW - 03 Apr 2007 - 09:30

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NandaLahiri

NEW - 13 Dec 2010 - 14:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NarcisaMartinez

NEW - 14 Aug 2015 - 11:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NatachaOpalka

r3 - 20 Nov 2009 - 12:36

Name: Natacha Opalka Email: opalkan@rockefeller.edu Company Name: Company URL: http://www.rockefeller.edu Location: RockefellerUOffice Country ...

NataliaOrlova

NEW - 11 Sep 2012 - 18:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NatalieKelly

r3 - 24 Nov 2008 - 17:31

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NatalyaGertsik

NEW - 18 Aug 2009 - 12:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NathanWill

r2 - 12 Jun 2012 - 11:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NathanielTraaseth

r2 - 01 Nov 2012 - 12:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NeerajKapoor

r2 - 25 Jul 2008 - 12:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NeilThomas

r2 - 02 Oct 2008 - 08:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NevilleKallenbach

r2 - 13 May 2008 - 10:46

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NiccolaPerez

NEW - 28 Jul 2010 - 13:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NicholasColangelo

NEW - 12 Aug 2014 - 10:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NicholasGao

NEW - 14 May 2015 - 11:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NicholasGeacintov

r3 - 02 Apr 2009 - 10:19

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NicholasHarbison

r3 - 30 Jun 2008 - 08:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NicholeOConnell

r2 - 11 Apr 2008 - 08:42

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

NickDoucet

r3 - 19 Aug 2008 - 18:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NickHarbison

NEW - 01 Feb 2007 - 16:07

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NicolasBiais

r3 - 20 Nov 2009 - 11:45

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

NicolasCoudray

r24 - 21 Apr 2016 - 09:39

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

NicoleBenvin

NEW - 08 Oct 2014 - 19:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NicoleBenvin2

NEW - 15 Mar 2015 - 16:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NicoleLeifer

NicoleLeifer

r2 - 18 Jun 2007 - 12:33

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

NicoleSampson

r3 - 02 Apr 2009 - 10:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

NihGuest

r2 - 12 Jan 2009 - 11:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NikaErjavec

NEW - 27 Oct 2008 - 11:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NikhilSingla

r4 - 20 Nov 2009 - 12:43

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

NikolaPavletich

NEW - 15 Jan 2015 - 09:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NikolaTrbovic

r3 - 23 Oct 2007 - 10:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NikolaosBiris

NEW - 17 Sep 2014 - 10:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NileshZaware

NEW - 23 Aug 2018 - 09:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NilsHalberg

r2 - 06 Mar 2013 - 14:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NimaY

NEW - 11 Sep 2012 - 12:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NimaYousefi

NEW - 19 Jan 2012 - 15:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NinaShapley

r5 - 20 Nov 2009 - 11:47

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

NingGao

r3 - 22 Sep 2009 - 08:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NmrTitration

r16 - 04 Feb 2010 - 16:28

Current function in Matlab LIBRARY:matlab/lib1/titrateKD.m function out titrateKD ( shifts, nomcon, protein, other) % % shifts a vs . ns matrix of shifts ...

NoahChodos

NEW - 08 Apr 2015 - 13:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NoorI

NEW - 19 Nov 2012 - 18:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NuzhatParveen

NuzhatParveen

r2 - 18 May 2023 - 10:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NysbcStaff

r2 - 17 Sep 2010 - 12:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OctaviSemonin

OctaviSemonin

r2 - 21 Jan 2015 - 16:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OlgaRechkoblit

NEW - 21 Jun 2011 - 13:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OlgaSerra

r2 - 02 Nov 2011 - 11:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OliverZerbe

r11 - 09 Jul 2008 - 16:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OliveraZivkovic

NEW - 08 Apr 2011 - 18:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OnyinyechukwuUchime

NEW - 12 Nov 2012 - 09:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OrSzekely

NEW - 06 Jun 2022 - 08:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

OscarChavez

NEW - 06 Aug 2013 - 10:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PPTriafolHoleyFilms

r21 - 19 Mar 2014 - 11:37

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols TRIAFOL METHOD Jump to Principles Holey carbon grids ...

PabloDeIoannes

r2 - 03 Dec 2007 - 09:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PabloPeixoto

NEW - 20 Sep 2010 - 12:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PadmanavaPradhan

NEW - 18 Jun 2007 - 16:30

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

PanDeng

NEW - 08 Jul 2014 - 01:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaoloRossi

r2 - 13 Nov 2007 - 23:05

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ParagPurohit

NEW - 01 Nov 2010 - 17:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ParamitaSarkar

ParamitaSarkar

r3 - 14 Jun 2011 - 13:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ParamjitArora

r4 - 01 Apr 2009 - 13:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ParminderKaur

NEW - 14 May 2012 - 14:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ParthaDatta

ParthaDatta

NEW - 12 Sep 2005 - 10:48

Name: ParthaDatta Email: ppd2k@yahoo.com Company Name: Wadsworth center Company URL: Location: WadsworthOffice Country: USA Comment ...

ParthaPatra

r2 - 24 Dec 2013 - 10:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ParthaSampathkumar

ParthaSampathkumar

r2 - 26 Sep 2014 - 14:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PatriciaRodriguez

PatriciaRodriguez

r103 - 15 May 2009 - 10:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PatrickBarre

r5 - 19 Jan 2010 - 16:04

Name: Patrick Barre Email%: Company Name: WMCCU Company URL: http://www. Location: WMCCUOffice Country: USA Comment: pmb2005 at med ...

PatrickLoria

r3 - 19 Aug 2008 - 18:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PatrickTrojer

r3 - 10 May 2007 - 10:07

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

PaulDeLeon

NEW - 05 Sep 2018 - 18:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulGottlieb

PaulGottlieb

r20 - 08 Jan 2013 - 14:21

Name: Paul Gottlieb Email: pgottl@med.cuny.edu Company Name: CUNY Company URL: Location: CUNYCCNYOffice Country: USA Comment: PI My ...

PaulHarvilla

TimZeiske

r4 - 11 Mar 2011 - 11:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulKussie

r3 - 10 Mar 2010 - 10:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulLeonard

r2 - 17 Jul 2008 - 14:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulMaragakis

PaulMaragakis

r3 - 16 Nov 2009 - 19:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulOBrien

NEW - 01 Sep 2011 - 13:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulPevsner

r4 - 11 Sep 2009 - 14:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulRobustelli

r4 - 12 Sep 2013 - 16:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulSideris

r2 - 03 Aug 2007 - 16:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PaulaUpla

r3 - 02 Nov 2011 - 12:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PawelPenczek

r6 - 24 Sep 2009 - 15:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PengRong

NEW - 31 Jan 2007 - 14:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

PengWu

r2 - 14 Sep 2006 - 13:43

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

PeterDemou

NEW - 09 Jul 2008 - 10:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PeterLipke

r4 - 02 Apr 2009 - 10:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PeterPalese

r3 - 01 Apr 2009 - 10:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PeterTakvorian

NEW - 27 Dec 2012 - 11:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PeterThoeny

r14 - 30 Jul 2007 - 16:43

Name: Peter Thoeny Email%: Comment: Peter is the author of TWiki and therefore a TWiki:Codev/CoreTeam member. See home page at TWiki:Main/PeterThoeny; Peter ...

PeterTonge

r3 - 22 Jan 2009 - 07:40

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

PetraT

r2 - 30 Mar 2008 - 07:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PetroffAlexander

NEW - 24 Jun 2014 - 14:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PhanikishoreDavineni

NEW - 09 Jul 2008 - 16:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PhilipChoi

NEW - 07 Oct 2014 - 14:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PhilipChuang

r3 - 16 Sep 2010 - 15:57

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

PhilippHenrich

PhilippHenrich

r4 - 17 Dec 2009 - 16:53

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

PhillipStallworth

PhillipStallworth

NEW - 10 Jan 2006 - 14:06

Name: Phillip Stallworth Email: pstallwo@sci.ccny.cuny.edu Company Name: City College Company URL: Location: CUNYCCNYOffice Country: USA ...

PhotiniSinnis

NEW - 11 Nov 2010 - 13:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PierluigiVitti

r2 - 08 Jun 2009 - 17:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PkPark

NEW - 24 Jan 2011 - 12:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PonisserilSomasundaran

PonisserilSomasundaran

r2 - 03 Oct 2009 - 12:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PremKaushal

PremKaushal

r2 - 16 Oct 2014 - 15:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PriyamvadaAcharya

NEW - 01 Jun 2015 - 10:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

PulikalluSashi

r3 - 17 Apr 2019 - 12:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QianFengXu

NEW - 23 Apr 2012 - 14:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QianWang

NEW - 07 Sep 2011 - 13:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QiangZhang

r2 - 20 Sep 2007 - 13:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QingCai

NEW - 10 Jan 2014 - 16:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QingFan

NEW - 22 Jun 2015 - 10:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QinshanGao

r2 - 27 Feb 2009 - 19:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

QiuXingJiang

r3 - 12 Sep 2007 - 11:04

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

QunLiu

r8 - 11 Aug 2009 - 08:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RachelKirshenbaum

r3 - 19 Mar 2013 - 16:06

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RadhaDevi

RadhaDevi

NEW - 20 Sep 2005 - 13:00

Name: Radha Devi Email: devir@rockefeller.edu Company Name: Rockefeller University Company URL: http://www.rockefeller.edu/blobel Location: RockefellerUOffice ...

RadhikaMalik

NEW - 17 Feb 2010 - 15:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RadhikaMalik22

NEW - 02 Oct 2015 - 14:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RafaelVazquezReina

NEW - 04 Jan 2012 - 12:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RajAgrawal

r2 - 20 Nov 2009 - 12:41

Name: RajAgrawal Email: agrawal@wadsworth.org Company Name: Wadsworth Ctr Company URL: http://www. Location: WadsworthOffice Country: USA ...

RajParulekar

NEW - 29 Sep 2014 - 16:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RajiEdayathumangalam

r4 - 07 Oct 2008 - 18:25

Name: Raji Edayathumangalam Email: raji@brandeis.edu Company Name: Brandeis University Company URL: Location: Other Country: USA Comment ...

RalphLasala

NEW - 17 Dec 2010 - 13:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RamiroMurata

NEW - 11 Feb 2010 - 16:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RandyAbramowitz

r3 - 09 Jul 2008 - 16:51

Name: Randy Abramowitz Email: randy@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: NYSBC BNL Country: USA ...

RanjaniVaradan

r2 - 23 Jan 2008 - 16:25

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RaviK

NEW - 10 Aug 2017 - 12:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RaviKalathur

RaviKalathur

r2 - 24 Sep 2012 - 19:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RavichandraBachu

r3 - 15 Jan 2009 - 10:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RaymondTu

RaymondTu

NEW - 18 Jan 2006 - 10:56

Name: Raymond Tu Email: tu@ccny.cuny.edu Company Name: CCNY Company URL: Location: CUNYCCNYOffice Country: USA Comment: Office phone ...

RebeccaHawkins

NEW - 17 Nov 2010 - 14:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RebeccaSmith

NEW - 13 Dec 2012 - 12:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RenZhen

r2 - 07 Apr 2008 - 16:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RenatoBruni

r4 - 08 Feb 2008 - 23:12

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RenjingWang

NEW - 18 Jun 2015 - 16:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RezaKhayat

NEW - 12 Oct 2012 - 11:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RhondaAlphonso

r4 - 30 Jul 2007 - 17:08

Name: Rhonda Alphonso Email: ralphonso@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country ...

RicardoPeguero

HarryMaitta

r3 - 18 Aug 2025 - 16:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardBurger

r2 - 22 Apr 2009 - 23:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardDelleBovi

r3 - 26 Apr 2012 - 15:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardFactor

r2 - 22 Jul 2009 - 13:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardGursky

r3 - 01 Sep 2009 - 09:49

Name: Richard Gursky Email%: gursky at wadsworth.org Company Name: Howard Hughes Medical Inistitute Company URL: http://www. Location: SUNYAlbanyOffice ...

RichardHarris

r4 - 31 Oct 2008 - 16:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardHite

r2 - 07 Jan 2013 - 17:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardPomerantz

r2 - 22 Apr 2009 - 23:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RichardVallee

NEW - 09 May 2008 - 20:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RickFetter

r5 - 12 Jan 2009 - 16:31

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

RinkuJain

r4 - 14 Oct 2008 - 16:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RivkahRogawski

NEW - 17 Jan 2012 - 15:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RizaDervisoglu

r2 - 24 Oct 2008 - 11:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobHynes

NEW - 29 Mar 2007 - 09:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RobertGeis

r2 - 22 Jan 2008 - 17:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobertGenco

r7 - 10 Aug 2010 - 14:11

Name: Robert Genco

RobertGheorhgita

NEW - 06 May 2019 - 15:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobertGrassucci

RobertGrassucci

r22 - 14 Jun 2011 - 12:22

Name: Robert Grassucci Email: rg2502@columbia.edu Company Name:Columbia University Dept of Biochemistry and Molecular Biophysics Company URL: http: ...

RobertGriffin

RobertGriffin

NEW - 15 Mar 2006 - 15:11

Name: Robert Griffin Email: griffin@ccnmr.mit.edu Company Name: MIT Company URL: http://www. Location: (Please specify office location) Country ...

RobertHincapie

NEW - 23 Jan 2024 - 14:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobertLanglois

r2 - 21 Sep 2009 - 12:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobertSinger

r3 - 10 Dec 2008 - 12:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobertSweet

r3 - 18 Dec 2008 - 10:18

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RobertTycko

r2 - 29 May 2007 - 17:06

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RobertoMercado

NEW - 02 Nov 2022 - 08:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RobertoSanchez

r2 - 17 Sep 2004 - 17:49

Name: Roberto Sanchez Email: roberto.sanchez@mssm.edu Company Name: MSSM Company URL: http://www.mssm.edu Location: MSSM Country: USA ...

RodMacKinnon

r2 - 29 Oct 2007 - 15:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RoderickFry

r3 - 05 May 2008 - 08:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RodrigoVasquez

r2 - 22 Dec 2009 - 12:28

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RohitRoy

NEW - 20 Sep 2022 - 14:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RominaMancusso

NEW - 03 Nov 2014 - 16:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RonaldKoder

RonaldKoder

r2 - 06 Dec 2017 - 16:22

Name: Ronald Koder Email: rkoder@ccny.cuny.edu Company Name: The City College of New York Company URL: http://www.sci.ccny.cuny.edu/physics/ Location ...

RongXu

r2 - 30 Oct 2007 - 13:14

Name: RongXu Email: xur@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country: USA Comment ...

RonnieGhose

r19 - 19 Mar 2009 - 16:14

Name: Ronnie Ghose Email: rghose@sci.ccny.cuny.edu Company Name: CUNY CCNY Company URL: http://www.ccny.cuny.edu http://www.sci.ccny.cuny.edu/~ghose ...

RowenaYew

NEW - 19 Sep 2013 - 13:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RubenDiaz

r6 - 01 Oct 2009 - 12:34

CatalaseCrystals My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

RubenSavizky

r2 - 21 Nov 2006 - 09:45

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RuchiGupta

r3 - 11 Nov 2009 - 08:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RufengWang

r3 - 09 Oct 2009 - 11:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RuiGalvao

NEW - 12 Aug 2015 - 10:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RupalGupta

NEW - 12 Sep 2018 - 14:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RuthStark

r20 - 24 Mar 2009 - 14:47

Name: Ruth Stark Email: stark@sci.ccny.cuny.edu Company Name: CUNY Company URL: Location:CUNYCCNYOffice Country: USA Comment: Dr. Ruth ...

RyanJohnston

NEW - 01 Oct 2012 - 10:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RyanKing

r2 - 22 Apr 2009 - 23:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RyanNotti

NEW - 08 Oct 2013 - 17:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

RyanSchreiner

r4 - 06 Nov 2008 - 08:19

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

RyoHayama

NEW - 21 Jan 2015 - 14:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SChandraShekar

r4 - 19 May 2008 - 12:22

Name: s chandra shekar Email: ss4481@nyu.edu Company Name: NYU Company URL: Location: NYUOffice Country: USA Comment: Personal Preferences ...

SabrinaSeetahal

NEW - 31 Jan 2020 - 12:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SachaDeCarlo

r13 - 29 Nov 2011 - 15:03

My Project Proposal My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal ...

SahanaBhattacharyya

NEW - 24 Jul 2018 - 17:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SaikatChowdhury

r4 - 24 Jan 2011 - 15:53

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

SalimaBahri

NEW - 18 Jan 2012 - 16:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SalvatoreValvo

r2 - 21 Apr 2009 - 19:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SamSanders

NEW - 02 Aug 2013 - 10:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SamarRizk

r2 - 11 Dec 2007 - 12:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SameerSingh

NEW - 07 Jan 2014 - 15:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SampadaKalan

r2 - 05 Oct 2009 - 11:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SamuelHandelman

r2 - 22 Jan 2009 - 22:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SamuelSparks

r3 - 17 Apr 2019 - 14:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SamuniLab

NEW - 29 May 2014 - 14:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SanatMandal

r2 - 21 Sep 2009 - 19:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SandipKaledhonkar

NEW - 18 Sep 2013 - 12:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SandipSur

r2 - 06 Aug 2009 - 11:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SandraBarral

NEW - 18 Aug 2009 - 10:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SantoshKumarUpadhyay

NEW - 10 Dec 2010 - 11:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SantoshKupadhyay

NEW - 09 Sep 2010 - 11:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SarahGoetz

r2 - 16 Sep 2010 - 16:00

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

SargisDallakyan

NEW - 11 Mar 2015 - 17:23

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SashaS

NEW - 18 Mar 2015 - 18:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SathishPonnurangam

r3 - 24 Feb 2010 - 15:52

My Links My Logbook .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

SayantaniSarkar

r2 - 20 Sep 2007 - 13:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ScottBlanchard

NEW - 06 Apr 2015 - 18:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ScottMcCallum

NEW - 16 Jun 2009 - 09:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SeanBrady

r3 - 02 Apr 2009 - 09:53

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

SeanCahill

SeanCahill

r6 - 31 Oct 2023 - 10:48

Name: Sean Cahill Email: sean.cahill@einsteinmed.org Company Name: AECOM Company URL: https://einsteinmed.edu/faculty/477/sean cahill/ Location ...

SebastianKlinge

NEW - 23 Sep 2014 - 19:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SebastianMcClendon

r2 - 14 Jan 2008 - 15:32

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

SebastianRussell

SebastianRussell

r2 - 10 Jan 2015 - 13:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SebastienAlphonse

SebastienAlphonse

r2 - 30 Nov 2010 - 17:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SebastienPoget

SebastienPoget

r10 - 20 Jul 2011 - 12:27

Name: Sébastien Poget Email: sebastien.poget@csi.cuny.edu Company Name: CSI/CUNY Company URL: http://www.chem.csi.cuny.edu/ Location: CUNYCSIOffice ...

SegoleneLaage

NEW - 15 Nov 2010 - 15:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SellTwiki

r6 - 31 Jan 2013 - 12:36

Major features Revision control complete audit trail, also for meta data such as attachments and access control settings. Provides identification of all contributors ...

SeongHoHong

NEW - 16 Feb 2018 - 16:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SerafimaGuseva

NEW - 17 Jan 2023 - 14:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SergeIlinSchneider

r3 - 25 Feb 2009 - 16:56

Name: Serge Ilin Schneider Email##: ilinschs at mskcc.org % no longer valid 12 Sep 2007 Company Name: MSKCC Company URL: http://www.mskcc.org ...

SethDarst

r8 - 02 Apr 2009 - 10:05

Name: Seth Darst Email: darst@rockefeller.edu Company Name: Rockefeller University URL: http://www.rockefeller.edu/research/abstract.php?id 32 ...

ShahidMirza

NEW - 18 Jul 2024 - 09:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShaiShaham

NEW - 14 May 2014 - 15:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShaneezaSalim

NEW - 12 Nov 2012 - 10:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShantelleTabuso

NEW - 24 Jan 2012 - 11:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShaoYingHua

r2 - 15 Jul 2010 - 16:53

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

ShaoyiLiu

NEW - 29 Oct 2013 - 11:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SharonGallagher

SharonGallagher

r2 - 18 Jun 2008 - 16:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SheedsDurse

r2 - 27 Jun 2008 - 09:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SherryllJones

r4 - 05 Oct 2009 - 11:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShiZhong

NEW - 20 Sep 2006 - 16:26

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ShibaniBhattacharya

ShibaniBhattacharya

r20 - 08 May 2008 - 13:09

Name: Shibani Bhattacharya Email: sbhattacharya@nysbc.org Company Name: NYSBC Company URL: Location: ParkBuildingOffice Country: USA ...

ShifengXiao

r3 - 29 Aug 2012 - 08:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShiftSparta

r10 - 16 Mar 2009 - 09:58

SPARTA: Shifts Predicted from Analogy in Residue type and Torsion Angle – NYSBC notes As described in the paper: Protein backbone chemical shifts predicted from ...

ShirleyTate

ShirleyTate

r2 - 18 Jul 2008 - 17:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ShivaniAhuja

ShivaniAhuja

r4 - 29 Nov 2006 - 14:12

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ShripadJoshi

r2 - 08 Feb 2010 - 12:51

My Links My Logbook .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

ShyamBhaskaran

ShyamBhaskaran

NEW - 10 Sep 2005 - 06:22

Name: Shyam Bhaskaran Email: sbhaskaran@mail.rockefeller.edu Company Name: The Rockefeller University Company URL: http://www.rockefeller.edu/labheads ...

ShyamVaidya

r3 - 15 Apr 2008 - 10:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SilasHartley

NEW - 16 Jun 2014 - 14:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SilmillyToribio

r2 - 08 Jul 2009 - 13:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SimonElsaesser

r2 - 13 Oct 2007 - 10:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SimoneGieschler

r4 - 09 Mar 2010 - 19:02

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

SnehanjaniShivakumar

NEW - 03 Nov 2015 - 11:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SohanDesilva

NEW - 11 Apr 2011 - 12:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SongXiang

r3 - 09 Oct 2009 - 11:23

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

SonikaBhatnagar

NEW - 05 Dec 2025 - 12:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SophiaSuarez

r4 - 02 Oct 2008 - 11:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SophieKorn

NEW - 13 Sep 2023 - 14:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SourabhBanerjee

r13 - 20 Nov 2009 - 12:43

Name: Sourabh Banerjee Email: sob2004@med.cornell.edu Company Name: Company URL: Location: WMCCU Country: USA Comment: was with Sakmar ...

SouradeepGupta

NEW - 18 Oct 2024 - 13:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SourajitMitraMustafi

NEW - 09 Sep 2010 - 11:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SozanneSolmaz

NEW - 20 Sep 2012 - 17:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SpencerBrucks

NEW - 16 Jun 2014 - 10:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SpyrosMonastiriotis

NEW - 17 Jul 2008 - 15:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StanislausWong

r2 - 16 Aug 2007 - 18:26

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

StephanieGeggier

StephanieGeggier

r2 - 01 Nov 2007 - 13:49

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

StephanieGu

NEW - 09 Jun 2022 - 08:46

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephaniePeters

NEW - 01 Aug 2012 - 14:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenBoyd

r3 - 06 May 2008 - 19:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

StephenGoff

r2 - 20 May 2009 - 14:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenJoy

NEW - 31 Aug 2011 - 14:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenKennedy

NEW - 17 Sep 2014 - 09:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenLong

StephenLong

r2 - 19 Feb 2015 - 10:45

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenMayclin

r2 - 21 Apr 2009 - 19:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenMiller

NEW - 01 Sep 2011 - 14:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StephenRieth

NEW - 02 Sep 2011 - 11:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StevanHubbard

SteveHubbard

r6 - 13 Nov 2009 - 11:57

Name: Steve Hubbard Email: stevan.hubbard@med.nyu.edu Company Name: NYUSOM Company URL: http://saturn.med.nyu.edu/research/sb/hubbardlab/ Location ...

SteveEinheber

SteveEinheber

NEW - 22 Nov 2005 - 13:21

Name: Steve Einheber Email: seinhebe@hunter.cuny.edu Company Name: Hunter School of Health Sciences Company URL: Location: CUNYHunterOffice ...

SteveGreenbaum

r2 - 12 Nov 2008 - 17:20

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

SteveTryon

r2 - 07 Oct 2009 - 12:04

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

StevenAlmo

r3 - 14 Nov 2008 - 12:53

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

StevenPolan

NEW - 20 Sep 2006 - 12:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

StevenRosenfeld

r2 - 06 May 2008 - 20:04

Name: Steven Rosenfeld Email: sr2327@columbia.edu Company Name: Columbia University Company URL: Location: ColumbiaMedCenterOffice Country ...

StevenSmith

r5 - 21 Jan 2008 - 20:24

Name: Steven Smith Email: steven.o.smith@sunysb.edu Company Name: Stony Brook University Company URL: http://sos.bio.sunysb.edu Location: SUNCYSBOffice ...

StewartRussell

r3 - 12 Sep 2013 - 16:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

StewartShuman

r4 - 03 Apr 2009 - 12:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SubhabrataDas

NEW - 31 Mar 2015 - 16:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SubhasishChatterjee

SubhasishChatterjee

r4 - 01 Sep 2009 - 10:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SubinShetty

NEW - 11 Jun 2024 - 11:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SunitaHumagain

NEW - 14 Dec 2017 - 14:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SupriyaPratihar

SupriyaPratihar

r2 - 29 Nov 2022 - 14:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SurasriSahu

NEW - 25 Jan 2012 - 17:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SusanMousavi

r2 - 10 Jan 2012 - 09:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

SusanWhite

r2 - 06 May 2008 - 20:04

Name: Susan White Email: sew2110@columbia.edu Company Name: Columbia University Company URL: Location: ColumbiaMedCenterOffice Country: USA ...

SwapnaGurla

SwapnaGurla

NEW - 11 Apr 2005 - 09:56

Name: Swapna Gurla Email: gvts@cabm.rutgers.edu Company Name: CABM, Rutgers University Company URL: http://www. Location: (Please specify office ...

SwatiHaldar

SwatiHaldar

r2 - 05 Jun 2024 - 12:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TWikiVariables

PeterThoeny

r3 - 11 Jan 2003 - 19:29

See .TWikiVariables

TamarSchlick

r2 - 17 Mar 2010 - 11:04

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

TamirGonen

r2 - 24 Sep 2009 - 22:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TanayaLahiri

NEW - 18 Nov 2010 - 14:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TanyaZaliznyak

NEW - 04 Oct 2006 - 13:38

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

TapojyotiDas

NEW - 18 Jan 2016 - 13:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TaposhGayen

NEW - 13 Aug 2012 - 11:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TapuShaikh

NEW - 06 Nov 2008 - 13:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TarunKapoor

r2 - 02 Apr 2009 - 10:25

Name: tarun kapoor Email: kapoor@rockefeller.edu Company Name: Rockefeller University Company URL: www.rockefeller.edu Location: RockefellerUOffice ...

TassaditeDahmane

NEW - 26 Jul 2022 - 15:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TatyanaIgumenova

r2 - 15 Oct 2007 - 11:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

TatyanaSysoeva

SachaDeCarlo

r3 - 22 Sep 2010 - 08:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TerryHenderson

r3 - 29 Aug 2008 - 11:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TerryWagenknecht

TerryWagenknecht

NEW - 06 Sep 2005 - 18:26

Name: TerryWagenknecht Email: terry@wadsworth.org Company Name: Wadsworth Ctr Company URL: http://www. Location: WadsworthOffice Country: ...

TestUse3

ArunachalamAlagappan

r5 - 16 Mar 2015 - 15:23

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

TestUser

TWikiGuest

r2 - 23 Aug 2004 - 14:29

Name: Test User Login Name: test1 Email: spam@tspllc.com Phone: Department: Location: (Please specify office location) Comment: ...

TestUser1

NEW - 16 Aug 2011 - 11:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TestUser2

NEW - 16 Aug 2011 - 12:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TestUser4

NEW - 26 Sep 2007 - 12:02

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TestUser5

NEW - 18 Oct 2007 - 16:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TestUser6

NEW - 29 Oct 2007 - 11:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThemisLazaridis

ThemisLazaridis

NEW - 13 Jun 2005 - 10:19

Name: Themis Lazaridis Email: tl@rilke.sci.ccny.cuny.edu Company Name: CCNY Company URL: http://mingus.sci.ccny.cuny.edu Location: CUNYCCNYOffice ...

TheresaCaltieri

NEW - 18 Sep 2013 - 11:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasDiacovo

NEW - 15 Jun 2011 - 12:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasDurbin

r3 - 12 Apr 2010 - 17:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasGarner

r3 - 17 Apr 2019 - 14:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasHaines

r5 - 28 Oct 2007 - 21:25

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ThomasHsiao

NEW - 23 Sep 2013 - 16:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasHuber

ThomasHuber

NEW - 06 Jun 2005 - 19:10

Name: ThomasHuber Email: hubert@mail.rockefeller.edu Company Name: Rockefeller University Company URL: Location: RockefellerUOffice Country ...

ThomasKelly

r4 - 23 Jan 2009 - 15:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasLeyh

r3 - 18 Jul 2008 - 14:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ThomasMelia

r7 - 20 Nov 2009 - 11:44

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

ThomasSakmar

r5 - 20 Jan 2010 - 08:11

Name: Thomas Sakmar Email: sakmar@mail.rockefeller.edu Phone: 212 327 8288 Company Name: RU Company URL: http://www.rockefeller.edu/research/abstract ...

ThomasSzyperski

r12 - 27 Sep 2009 - 11:13

Name: Thomas Szyperski Email: szypersk@chem.buffalo.edu Company Name: U at Buffalo Company URL: http://www.buffalo.edu Location: SUNYBuffaloOffice ...

ThompsonUkpebor

NEW - 24 Sep 2012 - 08:41

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TieuviNguyen

TieuviNguyen

NEW - 05 Oct 2005 - 17:12

Name: Tieuvi Nguyen Email: tieuvi@gmail.com Company Name: The City College of New York Company URL: http://www. Location: CUNYCCNYOffice Country ...

TijanaJovanovic

r2 - 06 Aug 2008 - 22:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TimBooth

r3 - 30 Aug 2007 - 21:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TimZeiske

r3 - 15 Dec 2011 - 12:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TimothyStevens

TimothyStevens

r2 - 22 Jul 2008 - 14:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TingWang

NEW - 10 Apr 2007 - 15:56

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

TingtingYang

TingtingYang

r2 - 18 Sep 2014 - 10:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Project proposal : CemProposalTingtingYang09181454 ...

ToddMiller

NEW - 04 May 2012 - 12:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TomMetzger

r2 - 03 Nov 2007 - 14:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TomNeubert

r6 - 02 Dec 2009 - 09:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TomiSawyer

NEW - 12 May 2008 - 17:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TonyMatos

r2 - 12 Jan 2008 - 15:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TonyYan

r2 - 08 Jan 2010 - 18:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ToshihiroAoki

NEW - 12 Feb 2007 - 10:36

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

TracieSengnouanchanh

NEW - 19 Aug 2011 - 11:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TracyGodfrey

r3 - 28 Mar 2008 - 02:06

Name: Tracy Godfrey Email : tracy (at) wadsworth.org Company Name: Company URL: Location: WadsworthOffice Country: USA Comment: ...

TravisJarrell

r3 - 19 Nov 2010 - 13:02

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

TravisMorgenstern

NEW - 06 Sep 2013 - 12:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TrumanBrown

r2 - 11 Jun 2009 - 13:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TsuyoshiKonuma

NEW - 15 Jan 2016 - 10:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TwodxRobotRepair

NicolasCoudray

r131 - 29 Jan 2015 - 08:52

(15.4; 688.1; 0.1) Robot Manuals (leave this at the top) Controller manual RCX142 e.pdf: rcx142 manual (this is most useful) RCX143 144 e 0322 v1.02.pdf ...

TwodxYiip

r76 - 04 Jul 2025 - 14:26

2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...

TwomeyEd

r2 - 05 May 2015 - 11:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TylerGrove

NEW - 13 May 2022 - 15:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

TzuChunTang

NEW - 10 Mar 2011 - 17:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

UlrichHammerling

r4 - 02 Apr 2009 - 10:22

Name: Ulrich Hammerling Email: U Hammerling@ski.mskcc.org Company Name: MSKCC Company URL: http://www. Location: MSKCCOffice Country: USA ...

UshatiDas

NEW - 13 Aug 2013 - 10:34

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VKaneDickson

r3 - 30 Sep 2009 - 11:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VadimPatsalo

r2 - 26 Aug 2008 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ValenciaJohnson

r3 - 08 Jun 2009 - 08:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ValeriaLorenzi

NEW - 02 Sep 2014 - 13:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VanessaCreswell

r5 - 08 Feb 2008 - 17:11

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

VasanthaKumar

NEW - 16 Nov 2020 - 16:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VenkataDandey

NEW - 16 Mar 2015 - 10:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VenkateshRamakrishnan

VenkateshRamakrishnan

r3 - 03 Dec 2010 - 14:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VeraMoiseenkovaBell

NEW - 20 Apr 2012 - 18:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VernSchramm

r5 - 17 Apr 2019 - 14:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VeronicaDudu

r4 - 20 Nov 2009 - 11:53

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

VeronicaMurray

NEW - 23 Apr 2012 - 11:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VesselinMiloushev

VesselinMiloushev

NEW - 07 Apr 2006 - 15:12

Name: Vesselin Miloushev Email: vzm1@columbia.edu Company Name: Columbia Company URL: http://cpmcnet.columbia.edu/dept/gsas/biochem/labs/palmer/ ...

VickyBevilacqua

r5 - 05 May 2008 - 08:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VictorUdinwe

NEW - 11 Apr 2011 - 16:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VictoriaDSouza

r5 - 31 Oct 2007 - 16:11

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

VikasJain

r2 - 18 Sep 2006 - 16:30

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

VincentFischetti

r6 - 02 Apr 2009 - 10:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VirginiaCornish

r6 - 02 Apr 2009 - 10:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VirginiaGarcia

VirginiaGarcia

r2 - 08 Oct 2014 - 16:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

VitalyKuryavyi

r2 - 17 Mar 2009 - 09:59

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

VladlenaKharchenko

NEW - 12 May 2023 - 11:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WaciumaMaina

NEW - 17 Sep 2012 - 13:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WanyiYen

r2 - 29 Nov 2011 - 14:10

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WayneHendrickson

r8 - 14 Nov 2008 - 12:49

Name: Wayne Hendrickson Email: wayne@convex.hhmi.columbia.edu Company Name: Columbia UP S Company URL: http://www.columbia.edu/cu/biology/faculty data ...

WebHome

r98 - 19 Sep 2013 - 14:33

How to do things at NYSBC \ Facilities and Laboratories at NYSBC ("Groups") Notices to Affiliates and Staff Get Affiliate Statistics (slow) Programs ...

WeiDong

r3 - 02 May 2008 - 07:13

Name: Wei Dong Email: wdong@sci.ccny.cuny.edu Company Name: City College of CUNY Company URL: Location: CUNYCCNYOffice Country: USA ...

WeiKan

NEW - 09 Sep 2010 - 10:04

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WeiLiLiu

r4 - 17 Apr 2019 - 14:18

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

WeiW

NEW - 22 Sep 2014 - 10:18

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WeiWang

NEW - 15 Nov 2007 - 11:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WeiminWang

NEW - 21 Jun 2007 - 14:12

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

WeiqiYang

NEW - 07 Jan 2016 - 14:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WenLing

NEW - 07 May 2007 - 17:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

WenboLi

r2 - 11 Feb 2008 - 17:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WenliMeng

r2 - 01 Sep 2008 - 14:44

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WenlinHuang

r2 - 23 Jun 2010 - 07:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WesleyChao

r3 - 17 Dec 2013 - 14:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WhitneyThomas

NEW - 04 Jan 2024 - 10:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WillaAppel

WillaAppel

NEW - 08 Oct 2004 - 07:44

Name: Willa Appel Email: appelw@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country: USA ...

WilliamBracken

r7 - 18 Apr 2008 - 17:07

aka WilliamBracken My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

WilliamCreasy

r3 - 05 May 2008 - 08:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

WilliamEWieczorek

WilliamEWieczorek

r3 - 02 Aug 2010 - 14:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WilliamM

NEW - 02 Apr 2014 - 12:52

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WilliamMarsiglia

NEW - 15 Jan 2015 - 16:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WilliamMatousek

r6 - 27 Jun 2008 - 09:04

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

WilliamMuller

r4 - 16 Aug 2008 - 09:11

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

WilliamPerea

r2 - 11 Apr 2008 - 18:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WilliamPineros

r2 - 09 Oct 2009 - 11:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WilliamPrice

NEW - 19 Sep 2006 - 13:23

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

WilliamWinter

WilliamWinter

r3 - 11 Aug 2008 - 15:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WillisaLiou

WillisaLiou

r2 - 17 Oct 2011 - 21:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WillyWriggers

NEW - 07 Aug 2013 - 17:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

WolfgangSchoefberger

r3 - 16 Aug 2007 - 18:24

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

WonSeokChoi

WonSeokChoi

r4 - 13 Sep 2011 - 22:49

My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

XabierAgirrezabala

r6 - 11 Apr 2009 - 13:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XavierBogle

NEW - 11 Sep 2012 - 14:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiaXiao

NEW - 29 Aug 2011 - 11:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiangLi

NEW - 04 Jul 2015 - 16:07

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiangXu

r2 - 31 Dec 2008 - 04:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiangpengKong

r7 - 02 Apr 2009 - 10:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiangshuJ

r3 - 08 Feb 2010 - 13:11

My Links My Logbook .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...

XiangshuJin

r2 - 12 Jan 2009 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiaochunYang

r2 - 27 May 2010 - 16:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiaohuiNi

r2 - 25 Aug 2009 - 12:19

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XiaojunHuang

r2 - 13 Feb 2009 - 15:57

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

XiaominYang

r2 - 22 Jan 2008 - 12:57

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

XiaotianTong

r4 - 02 May 2008 - 12:20

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

XiaoweiHou

NEW - 03 Apr 2015 - 15:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XinPeng

XinPeng

r2 - 28 Oct 2013 - 19:17

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XinYunHuang

r2 - 23 Jan 2009 - 07:26

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XinchaoYu

NEW - 25 Oct 2012 - 11:28

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XingMeng

r2 - 25 Feb 2010 - 08:57

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XinyunHuang

r4 - 08 Mar 2009 - 12:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XuYang

r2 - 23 Jan 2008 - 10:27

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XuYi

NEW - 18 Jan 2018 - 14:56

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

XuejunJiang

r3 - 20 Nov 2009 - 11:55

My Project Log My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

XulunZhang

NEW - 22 Aug 2007 - 16:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YachuHsu

NEW - 21 Jul 2015 - 10:40

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YacobGomez

r5 - 20 Nov 2009 - 12:15

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

YanDeng

NEW - 22 Feb 2018 - 11:38

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YanLi

r4 - 07 Feb 2008 - 13:13

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YanXiong

NEW - 23 Aug 2018 - 17:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YangLuo

NEW - 16 Jun 2022 - 10:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YangWu

NEW - 23 Jul 2013 - 22:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YanqiChang

NEW - 17 Sep 2013 - 11:49

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YanyanHu

NEW - 08 Apr 2011 - 18:42

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YelenaLerman

NEW - 09 Sep 2010 - 11:36

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YeongjoonLee

NEW - 22 May 2023 - 14:29

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YiHu

NEW - 17 Aug 2011 - 11:35

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YiPan

NEW - 16 Feb 2011 - 10:15

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YiRen

r2 - 30 Jan 2014 - 11:39

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YiYingChou

r4 - 28 Feb 2009 - 16:13

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YibingShan

r4 - 12 Nov 2009 - 11:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YihuX

NEW - 17 Jun 2015 - 20:59

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YihuXie

r2 - 02 Oct 2008 - 17:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YiminDong

YiminDong

NEW - 12 Sep 2005 - 11:02

Name: Yimin Dong Email: dyimin@wadsworth.org Company Name: Wadsworth Center, New York State Dept of Health Company URL: Location: WadsworthOffice ...

YiminMiao

NEW - 26 Mar 2018 - 21:00

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YiminXu

r2 - 06 Sep 2006 - 16:30

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YiminXume

r2 - 29 Oct 2007 - 12:16

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YinLi

r4 - 16 Sep 2008 - 13:24

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YingXu

NEW - 15 Sep 2011 - 10:08

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YingjieLi

r3 - 25 Mar 2009 - 09:47

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YingkaiZhang

YingkaiZhang

NEW - 25 Jul 2005 - 18:26

Name: Yingkai Zhang Email: yz22@nyu.edu Company Name: New York University Company URL: http://www.nyu.edu/projects/yzhang/ Location: NYUOffice ...

YingluZhang

NEW - 22 Mar 2015 - 23:05

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YizhouLiu

NEW - 03 Mar 2011 - 13:21

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YizhuoYang

YizhuoYang

r2 - 29 May 2019 - 11:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YoelShkolnisky

r2 - 10 Mar 2010 - 10:47

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YongLiu

NEW - 30 Jun 2015 - 18:37

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YongNengYao

r3 - 07 Jul 2008 - 13:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YongZiTan

r2 - 13 Feb 2019 - 22:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YongshengShi

r4 - 25 Feb 2009 - 17:18

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YoonhuiSung

YoonhuiSung

NEW - 12 Sep 2005 - 15:08

Name: Yoonhui Sung Email: yos2002@med.cornell.edu Company Name: Weill cornell gradugate school Company URL: http://biomedsci.cornell.edu/graduate school ...

YounjooLee

r6 - 05 Nov 2008 - 17:54

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on the style of Intranet (TWiki) for beginners ...

YouzhongGuo

NEW - 02 Jul 2015 - 18:11

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YuBingwu

NEW - 26 Oct 2006 - 12:01

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YuZhao

r8 - 20 Nov 2009 - 11:49

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

YuZhong

r2 - 11 Jul 2012 - 15:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YuanLin

r2 - 13 Sep 2010 - 09:14

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YuanTian

r4 - 02 Jun 2010 - 17:23

Name: Yuan Tian Email: yut2002@med.cornell.edu Company Name: Sloan Kettering Institute Company URL: http://www. Location: MSKCCOffice Country ...

YudongHao

DongNiu

r2 - 05 Oct 2012 - 13:54

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YuefengTang

r2 - 01 Feb 2008 - 12:55

Name: Yuefeng Tang Email%%: yuetang@ic.sunysb.edu Company Name: SUNY at Stony Brook Company URL: Location: SUNCYSBOffice Country: USA ...

YuehawKhoo

NEW - 05 Dec 2011 - 09:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YufengWei

r6 - 02 Sep 2009 - 18:24

Name: Yufeng Wei Email: weiy@mail.rockefeller.edu Company Name: Rockefeller University Company URL: Location: RockefellerUOffice Country ...

YuhangChen

NEW - 29 Jul 2007 - 19:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YunBai

NEW - 24 Jul 2007 - 13:43

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YunHuang

NEW - 18 Jan 2016 - 13:33

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YunLu

NEW - 14 May 2014 - 15:31

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YunpuLi

NEW - 03 Jun 2008 - 13:55

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YunyaoXu

AshleighRaczkowski

r2 - 04 Oct 2017 - 10:16

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YutingHuang

YutingHuang

r2 - 16 Jan 2007 - 12:14

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

YuvalKluger

r4 - 15 Aug 2007 - 11:09

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YuyingGosser

r2 - 03 May 2010 - 10:20

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

YvesSere

NEW - 05 Sep 2014 - 14:03

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZaaraSarwar

NEW - 05 Jun 2013 - 11:32

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZacharyFreyberg

NEW - 06 Sep 2013 - 12:22

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZeevDagan

r5 - 23 Jan 2009 - 15:12

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhangB

NEW - 01 Aug 2011 - 11:53

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhannaHakhverdyan

r2 - 14 Sep 2009 - 18:30

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhantongMao

r3 - 01 Sep 2009 - 09:58

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhenRen

r2 - 14 Jan 2008 - 12:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZheningZhang

NEW - 03 Jun 2013 - 09:48

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhiLiu

r2 - 16 Aug 2007 - 15:18

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

ZhitaiHao

NEW - 20 Apr 2016 - 12:25

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhiyuSun

NEW - 18 Jan 2018 - 14:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZhuangHao

NEW - 02 Mar 2016 - 18:01

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZimeiBu

r7 - 11 Aug 2010 - 15:51

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZinaidaKhanimova

NEW - 30 Nov 2009 - 13:50

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

ZsoltZolnai