2dx Overview Contents Protocols Computing... crash total computer: ssh from another machine sudo init 3 sudo kill 9 whatever Xorg sudo init ...

Contents CCPN WORKSHOP AT NYSBC, 8 Sep 2008 , A 11 REGISTRATION STEPS 1 If you want to use the software, you need to register with CCPN http://www.ccpn.ac ...

Contents Player required for arf video files nbr2player.msi: MS windows player for arf files Lectures Structure Validation and Fitting Dec. 9 Lecture ...

5/9/2012: Advances in Fluorescence Microscopy of the Cell Please join us for a second single molecule workshop at the New York Structural Biology Center. Time: 9 ...

Courses and Seminars related to !CryoEM At the NYSBC CEM User meeting and Annual BBQ Event: CEM user meeting Location: NYSBC, Room A 11 Time: Friday, August 22, ...

(Archive)Courses and Seminars related to !CryoEM 2013 At the NYSBC Semester long Course : "Cryoelectron Microscopy of Macromolecular Assemblies" This comprehensive ...

Contents Registrants for the FIB/SEM workshop on Jan 26 Name Email Institution Bob Grasucci rg2502@columbia.edu COLU Cheri Hampton cheri ...

2018 Hayama, R., Sparks, S., Hecht, L.M., Dutta, K., Karp, J.M., Cabana, C.M., Rout, M.P., and Cowburn, D. (2018). Thermodynamic characterization of the multivalent ...

Contents FeedBack of meetings etc MetaGroup with BruceJohnson Hello Kaushek, it was a great workshop; i thoroughly enjoyed the tutorial by dr. bruce johnson ...

Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...

Contents MALS MALS MALS Set ALLOWTOPICVIEW RalphLasala 14 Jan 2013 01 General MALS Theory 2012.pptx: General MALS Theory 02 Flow Cell Cleaning ...

META GROUP MEETINGS #8211; NYSBC Held in A 11 Park Building NEXT MEETING ... We would like to provide each participating group the opportunity to conduct ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise New in 2006 Round Table discussions of technical topics and application ...

2007 Calendar Year DATE EVENT 25 Jan 2007 THURSDAY NOON VISITOR SEMINAR, Dr. Chiara Pastore, NIMR London, 'Insights into Iron Sulphur cluster ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq 2008 ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq 2009 ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq ...

TWO DAY NMRViewJ WORKSHOP February 18 19, 2010 10:00am – 4:00pm Burce Johnson of One Moon Scientific has kindly agreed to give a two day workshop on NMRViewJ. This ...

Contents COURSE ANNOUNCEMENT Title: Biochemistry GR6270 NMR Spectroscopy of Macromolecules Instructors: Arthur G. Palmer Department of Biochemistry and Molecular ...

All instruments now automatically allocated See NmrScheduleTest The availability of 750 and 900 MHz Solid state probes can be found at SolidsProbestatus ...

All instruments now automatically allocated See NmrScheduleTest The availability of 750 and 900 MHz Solid state probes can be found at SolidsProbestatus ...

Requests for DNP spectrometer time can submitted at DnpNmrSchedule The availability of 750 and 900 MHz Solid state probes can be found at SolidsProbestatus ...

Requests for DNP spectrometer time can submitted at DnpNmrSchedule The availability of 750 and 900 MHz Solid state probes can be found at SolidsProbestatus ...

Requests for DNP spectrometer time can submitted at DnpNmrSchedule The availability of 750 and 900 MHz Solid state probes can be found at SolidsProbestatus ...

Contents NMR Solid State Short Course Solid State NMR WHO The short course for NMR is a training period for spectrometer ...

NYSBC operates solution state NMR spectrometers at 500, 600, 700, and 800 (x3) MHz and 900 (x2) MHz. A 750 WB and part of one 900 time are used for solids. See ...

CEM Workshop 21 Sep 04 DavidCowburn 07 Sep 2004 JPG: JPG: JPG: JPG: JPG: JPG: JPG: ...

Name: Ruth Stark Email: stark@sci.ccny.cuny.edu Company Name: CUNY Company URL: Location:CUNYCCNYOffice Country: USA Comment: Dr. Ruth ...

Nov 2008 Scientific Report, NYSBC Figure contents described on last page. Introduction In order to provide Principal Investigators and ...

PROTOCOLS from Stokes Lab Members Cell Culture yeast growth protocol vink.doc: Yeast Culture (Martin Vink) 12/2007 Yeast cultures.doc: Yeast culture protocol ...

TEMIMPS annual meeting materials.doc: meeting materials workshop agenda 4 10 2012.doc: Pre meeting workshop TemimpsMeetingSchedule2012 Attending Title ...

Transcontinential Initiative for Membrane Protein Structure Meetings Temimps Monthly Meetings TemimpsAnnualMeeting2013 TemimpsAnnualMeeting2012 ...

Schedule for the TEMIMPS Annual Meeting April 10 11, 2012 Tuesday April 10 10:00 David: detergent calculator 10:30 Nicolas: 2dx parameter matrix ...

Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...

Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...

TEMIMPS Workshop in Electron Crystallography Lecture Materials August 15 19, 2011 University of Washington School of Medicine, Seattle, Washington Lectures Lecture ...

Contents TEMIMPS Workshop Schedule 2011 Monday Aug. 15 Tuesday Aug. 16 Wednesday Aug. 17 Thursday Aug 18 Friday Aug. 19 0830 Lecture: WelcomeLogistics and Introduction ...

Workshop in Dual Beam Scanning Electron Microscopy at the New York Structural Biology Center This workshop will introduce the new Helios 650 Nanolab microscope at ...

Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...

2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...