2dx SoPIP 2D crystallization General Information Amino acid chain (A mutant) MGHHHHHHSSGVDLGTENLYFQSSMWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWP QALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQL ...
2dx EmrE (Lactobacillus plantarum) 2D crystallization trials Properties Amino acid sequence without tag: M T W I Y L I I G G L F E V V W A T M M K L S N G F ...
2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...
Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...
TargetTrack TargetTrack, a target registration database, provides information on the experimental progress and status of targets selected for structural determination ...
List of NYSBC Intranet users Please take the time and add yourself to the list. To do that fill out the form in Registration. This will create an account for you ...
Sesame Database Link http://sesame.nysbc.org/sesame/ Link is sheherazade. Overview See Laboratory Information Management System SESAME.pptx. Register someone See ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents Past EM Journal Clubs and seminar speakers 31 Oct 2011 4 pm Richard Henderson : MRC Laboratory of Molecular Biology, Cambridge, UK, "What is needed ...
Micro dialysis plates Overview (Martin's archive July 2010) Design An advantage of 2D crystallization relative to 3D crystallization is the use of relatively low ...
Tests of the micro dialysis plates performances Reference See MicroDialysisPlatesTool for an overview and information about the protocol. Experiments; test of the ...
Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...
Detergent Removal with Cyclodextrine Experiments Contents Overview, references... Experiments 2011, August 25th Tuesday's meeting comment CD Yiip in microdialysis ...
Contents Signup for sample prep equipment Rules signup on a first come first served basis signup with your !TwikiName list the time period you want ...
Contents CemMicroscopeTrainingArchive CEM microscope training sessions Open Training Days are microscope training sessions required before you may sign up for ...
Carbon grids preparation Contents Carbon Grid Preparation Plastic film Materials 1. Ni or Cu grid (400 mesh) 2. paper 3. glass jar 4. plastic petri dish ...