2dx EmrE 2D crystallization trials Experiment of Mai 2011 (X71) Protocol About the protein: see the Protein acquisition form. conditions to screen: Dialysis ...
2dx EmrE (Shewanella Oneidensis) 2D crystallization trials Properties Amino acid sequence: M S W L L L I L A G L F E I G W A I G L K Y T D G F T R L W P S V ...
2dx SFV 2D crystallization Contents Overview Experiments (date of protein delivery) July 1st 2009 Screen reference: X31 Conditions of best results (diffracting ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents Ed's Overview of EM (cartoon version) Choice of an appropriate structural biological technique Before beginning a project one must match the biological ...
Visit the !CryoEM web site at http://www.nysbc.org/facilities/CEM Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 4th year at ...
Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Cryoelectron Microscopy of Macromolecular Assemblies COURSE EVALUATION CEM ...
Contents Dec 9 Visualization, Interpretation and Docking (Hernando Sosa) Lecture Presentation lecture dec9.mp3: audio of Dec 9 lecture Dec 2 Digital ...
Contents Player required for arf video files nbr2player.msi: MS windows player for arf files Lectures Structure Validation and Fitting Dec. 9 Lecture ...
CEM Course Paper Topics Final papers are due on Dec 12. Send pdf to stokes@nyu.edu Papers should be no more than 5 pages of text for the body. Figures ...
CEM Course Paper Topics Final papers are due on Dec 11. Send pdf to stokes@nyu.edu Papers should be about 5 pages of text for the body. Figures should ...
Final papers are due on Dec 13. Send pdf to stokes@nyu.edu Papers should be about 5 pages of text for the body. Figures should be included to illustrate ...
Final papers are due on Dec 15. Send pdf to stokes@nyu.edu Papers should be about 5 pages of text for the body. Figures should be included to illustrate ...
Final papers are due on Dec 20. Send pdf to stokes@nyu.edu Your paper should be about 5 pages of text for the body. Figures should be included to illustrate ...
Contents Final papers are due on Dec 20. Send pdf to stokes@nyu.edu Your paper should be about 5 pages of text for the body. Figures should be included ...
Cryoelectron Microscopy of Macromolecular Assemblies 2007 NYU course # G16.4408 3 credits for lectures, 1 credit for practicals credit also available at other ...
Cryoelectron Microscopy of Macromolecular Assemblies 2010 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...
Contents Practical Sessions Homework : preparation for practical session II Download and install IMOD on your mac/pc/linux system Get the latest stable ...
Capabilities of NYSBC's CEM Lab Printable Brochure General Information The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate ...
Capabilities of NYSBC's CEM Lab General Information The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate the intermolecular interactions ...
IT resources at the CEMfac TemimpsTwikiToWebList add TWiki pages to TEMIMPS web site CemTwikiToWebList add TWiki pages to public web site CemTwikiToWebListTest ...
Capabilities of NYSBC's CEM Lab Printable Brochure Introduction The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate the intermolecular ...
Visit Cryo EM website at http://www.nysbc.org/facilities/CEM !CryoEM facility at NY Structural Biology Center CapabilitiesCEM.doc: MS Word version CapabilitiesCEM ...
Capabilities of NYSBC's CEM Lab General Information The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate the intermolecular interactions ...
Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Electron Crystallography Jump to Principles 2dx subsub ...
Principles Protocols Single Particle For single particle projects, we are using two packages: SPIDER and EMAN In general, EMAN is easier to use and get ...
Contents Leginon/Robot Technical Guide Minghui robot tech guide.doc: Robot Technical Guide (MS Word format) Leginon Update As of Feb 2010, Leginon is under major ...
Contents User Guide for Robot/Leginon on JEOL 1230 Minghui Hu Friday, February 26, 2010 Minghui Leginon setup guide.doc: MS Word version PC access abc123 Checklists ...
(Archive)Courses and Seminars related to !CryoEM 2013 At the NYSBC Semester long Course : "Cryoelectron Microscopy of Macromolecular Assemblies" This comprehensive ...
Customise this topic; samples and ideas available at TWiki:TWiki.WebLeftBarCookbook. My links: My home page CEM facility page CEM Microscope Schedule ...
Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...
Contents Prerequisites 1 python 1 gtk and glib. If the FSU software has been installed already then the required libraries should already be present 1 wxGTK ...
My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...
NYU email lists (moderated only accepted from inside NYUSOM, use david.stokes@med.nyu.edu and smtp.med.nyu.edu) see https://listservprivate.med.nyu.edu/scripts ...
CEM Microscope Schedule CEM Microscope Allocations This process is summarized in CemSchedulingOverview Calendar below represents preallocation of microscope ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...
TEMIMPS Workshop in Electron Crystallography Lecture Materials August 15 19, 2011 University of Washington School of Medicine, Seattle, Washington Lectures Lecture ...
Contents TEMIMPS Workshop Schedule 2011 Monday Aug. 15 Tuesday Aug. 16 Wednesday Aug. 17 Thursday Aug 18 Friday Aug. 19 0830 Lecture: WelcomeLogistics and Introduction ...
2dx Crystallization experiments set at NYU Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW NicolasCoudray 14 Jul 2014 Most recent ...
2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...
2dx Controls X368 Controls in new 3D printed plate (square chambers) frozen protein tested: yiiP (Salvatore), yiiP (John), CysZ, Bor1p, YetJ, BAT14 Set in 3D printed ...
2dx CD47 2D crystallization Info Protein from Ravi Human membrane proteins for 2D crystallization trial, CD47. It is stable during expression and purification from ...
2dx Claudin 15: 2D crystallization General 2dx information the protein can be frozen (still leads to 3D crystals) stable at 4C for 2 weeks at least ...
2dx CysZ Pseudomonas aeruginosa Transporter 2D crystallization Info 2 stains: PA01 and PA7 The first aeruginosa is Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 ...
2dx EmrE (Lactobacillus plantarum) 2D crystallization trials Properties Amino acid sequence without tag: M T W I Y L I I G G L F E V V W A T M M K L S N G F ...
Calibration and Parameter setting of 2DX Robot Vacuum set points vacuum set points for insertion and extraction are contained in the file ~/robot software/robot ...
2dx SoPIP 2D crystallization General Information Amino acid chain (A mutant) MGHHHHHHSSGVDLGTENLYFQSSMWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWP QALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQL ...
Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...
2dx UMA mutant 2d crystallization Mutant of UMA. X209 Lipids at MSSM The UMA triple mutant solubilized in detergent 1% DDM and then Ni NTA purification was in ...