2dx EmrE 2D crystallization trials Experiment of Mai 2011 (X71) Protocol About the protein: see the Protein acquisition form. conditions to screen: Dialysis ...
2dx EmrE (Shewanella Oneidensis) 2D crystallization trials Properties Amino acid sequence: M S W L L L I L A G L F E I G W A I G L K Y T D G F T R L W P S V ...
2dx SFV 2D crystallization Contents Overview Experiments (date of protein delivery) July 1st 2009 Screen reference: X31 Conditions of best results (diffracting ...
Biomek NXP robot Contents Before each use Empty the "Waste" bottle if it is almost full Check the level of water in the "Source" bottle. It should be well ...
Carbon grids preparation Contents Carbon Grid Preparation Plastic film Materials 1. Ni or Cu grid (400 mesh) 2. paper 3. glass jar 4. plastic petri dish ...
Contents Annual CEM BBQ 22 August 2014 CEM User meeting and Annual BBQ cembbq2014.pdf: 2014 flier Event: CEM user meeting Location: NYSBC, Room A 11 Time ...
Contents 20130807 ArgC Nanodisc staining. 1/10 dilution of stock in TBS. 20 sec air glow discharge of continuous carbon on copper grids. 4 uL incubated ...
Contents CemMicroscopeTrainingArchive CEM microscope training sessions Open Training Days are microscope training sessions required before you may sign up for ...
Contents Instructions This calendar is to be used only for weekend/ holiday schedules, or for night time work (starting past 6pm) Please, only 24 hour users ...
Please Use the New Scheduler This page kept for historical reasons If you do not yet have an account, please email emg@nysbc.org Rules for Requests ...
Reading and setting robot coordinates in robot controllers Manual robot control and hand controller operation using iRobot to manually control robot movement ...
Contents Leginon/Robot Technical Guide Minghui robot tech guide.doc: Robot Technical Guide (MS Word format) Leginon Update As of Feb 2010, Leginon is under major ...
Contents User Guide for Robot/Leginon on JEOL 1230 Minghui Hu Friday, February 26, 2010 Minghui Leginon setup guide.doc: MS Word version PC access abc123 Checklists ...
Contents Signup for sample prep equipment Rules signup on a first come first served basis signup with your !TwikiName list the time period you want ...
Contour Plot Map If you have a helical tube and want to create a flat projected map: Convert the final layer line file (.lmt or .2fd) into Toyoshima's format ...
Detergent Removal with Cyclodextrine Experiments Contents Overview, references... Experiments 2011, August 25th Tuesday's meeting comment CD Yiip in microdialysis ...
DSA for DC: Matlab program (Drop Shape Measurement for Detergent Concentration quantification) Contents Program Installation DSA for DC is a matlab program developed ...
Experiments Detergent Concentration Calibration curves using the drop shape measurement method Contents Theoretical values From Anatrace: Detergent Abbreviation ...
Surface tension measurement to determine detergent concentration in a solution; tool description Background The propensity of detergents to alter the surface properties ...
Protein handling, lipid preparation and setup of dialysis block at NYSBC, by Martin Vink, 12/2008. Contents All calculations in the text (under “Set up dialysis block ...
Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...
Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Helical Reconstruction using EMIP This protocol uses software that originated ...
Room 118 LogBook; experiments, debugging and updating... Manual use of 1230 1. Check the robot is not running (Leginon would appear and run on the main screen ...
Toggle Switches on the jeol1230 room 118 The toggle switch can be set to "robot" or "manual". When in 'manual' position, the toggle switch "pump/air" of the microscope ...
Contents Nota: next updates of Leginon should be done on jeol1230 and on cem12. April Mai 2011 Modification of pyscope/jeol1230.py see jeol1230.py Autofocus ...
Automation of jeol1230 with iRobot, Leginon and Animated TEM Contents Startup User manual to use Leginon combined with the Matlab nodes associated to the Animated ...
Tests of the micro dialysis plates performances Reference See MicroDialysisPlatesTool for an overview and information about the protocol. Experiments; test of the ...
Micro dialysis plates Overview (Martin's archive July 2010) Design An advantage of 2D crystallization relative to 3D crystallization is the use of relatively low ...
CEM Microscope Schedule CEM Microscope Allocations This process is summarized in CemSchedulingOverview Calendar below represents preallocation of microscope ...
Contents Past EM Journal Clubs and seminar speakers 31 Oct 2011 4 pm Richard Henderson : MRC Laboratory of Molecular Biology, Cambridge, UK, "What is needed ...
Sesame Database Link http://sesame.nysbc.org/sesame/ Link is sheherazade. Overview See Laboratory Information Management System SESAME.pptx. Register someone See ...
TLC of lipids and detergents – Martin's procedure Materials TLC Silica gel 60 W F254 These instructions are relevant for these plates only. They can be ordered ...
List of NYSBC Intranet users Please take the time and add yourself to the list. To do that fill out the form in Registration. This will create an account for you ...
Contents TEMIMPS members Iban Ubarretxena , Andreas Engel , Pawel Penczek , Tamir Gonen , James Love , David Stokes cc: Changki Kim , Guozhi.Tao@uth.tmc.edu, goragot ...
Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...
Thermoshake Program tcontrol.zip Other info (from inheco contact) Attached is the DLL Command Set. you will find the description of the error 16 (No or false Modbus ...
2dx Crystallization experiments set at NYU Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW NicolasCoudray 14 Jul 2014 Most recent ...
2D crystallization database Data mining from a recent review by Abeyrathne et al., which tabulated successful 2D crystallization experiments from the literature, allowed ...
2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...
2dx Controls X368 Controls in new 3D printed plate (square chambers) frozen protein tested: yiiP (Salvatore), yiiP (John), CysZ, Bor1p, YetJ, BAT14 Set in 3D printed ...
2dx CD47 2D crystallization Info Protein from Ravi Human membrane proteins for 2D crystallization trial, CD47. It is stable during expression and purification from ...
2dx Claudin 15: 2D crystallization General 2dx information the protein can be frozen (still leads to 3D crystals) stable at 4C for 2 weeks at least ...
2dx CysZ Pseudomonas aeruginosa Transporter 2D crystallization Info 2 stains: PA01 and PA7 The first aeruginosa is Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 ...
2dx EmrE (Lactobacillus plantarum) 2D crystallization trials Properties Amino acid sequence without tag: M T W I Y L I I G G L F E V V W A T M M K L S N G F ...
(15.4; 688.1; 0.1) Robot Manuals (leave this at the top) Controller manual RCX142 e.pdf: rcx142 manual (this is most useful) RCX143 144 e 0322 v1.02.pdf ...
2dx SoPIP 2D crystallization General Information Amino acid chain (A mutant) MGHHHHHHSSGVDLGTENLYFQSSMWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWP QALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQL ...
2dx UMA mutant 2d crystallization Mutant of UMA. X209 Lipids at MSSM The UMA triple mutant solubilized in detergent 1% DDM and then Ni NTA purification was in ...