r98 - 19 Sep 2013 - 14:33:52 - BillRiceYou are here: TWiki >  Main Web  > WebHome
Searched: ^t

Results from Main web retrieved at 22:27 (Local)

TLC of lipids and detergents – Martin's procedure Materials TLC Silica gel 60 W F254 These instructions are relevant for these plates only. They can be ordered ...
TWiki Contributor Not an actual user of this site, but a person devoting some of his/her time to contribute to the Open Source TWiki project. TWikiContributor lists ...
Member list: Set GROUP , Main.Others... Persons/group who can change the list: Set ALLOWTOPICCHANGE , GroupNames, .TWikiAccessControl ...
Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW DavidCowburn 22 Aug 2009
The TWikiGuest User A guest of this TWiki web, not unlike yourself. You can leave your trace behind you, just add your name in .TWikiRegistration and create your own ...
Site level preferences are located in however this .TWikiPreferences prefs topic has overrride priority and should be used for local customisations. This allows ...
The TWikiRegistrationAgent User This is a TWiki User used by TWiki when it registers new users. This user has special access to write to , and does not need an entry ...
List of NYSBC Intranet users Please take the time and add yourself to the list. To do that fill out the form in Registration. This will create an account for you ...
Protein E of tad locus
F protein of tad locus
V'th protein of tad locus
l talarate dehydratase
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
TargetTrack TargetTrack, a target registration database, provides information on the experimental progress and status of targets selected for structural determination ...
Name: tarun kapoor Email: kapoor@rockefeller.edu Company Name: Rockefeller University Company URL: www.rockefeller.edu Location: RockefellerUOffice ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents Sample Insertion InsertRoomTemperatureSample InsertCryoSample Tecnai F20 Problems Instructions to Retrieve CCDBlankEnable Film Jam Access ...
Tecnai F20 The Tecnai F20 operates with an accelerating voltage of 200kV. It is equipped with a Schottky field emission gun. The tip on this instrument was replaced ...
FEI TF20 Microscope Parameters wavelengths 200kV: 0.02508 A objective lenses f Cs 2.1 mm Chromatic aberration Aperture Sizes Condensor ...
Visit the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tecnai F20 (basic operations) TEM data computer controls Fast Scan CCD holds data and provides ...
TEMIMPS Annual Meeting, April 19, 2011 TEMIMPS annual meeting agenda.doc: Agenda TEMIMPS annual meeting materials.pdf: Meeting Materials TEMIMPS Guests ...
TEMIMPS annual meeting materials.doc: meeting materials workshop agenda 4 10 2012.doc: Pre meeting workshop TemimpsMeetingSchedule2012 Attending Title ...
3rd TEMIMPS Annual Meeting Boston April 30 May 1, 2013 TEMIMPS annual meeting directions.pdf: TEMIMPS annual meeting directions.pdf TEMIMPS Third annual ...
Example entry 02 Feb 2011 MCMJR1 27 Jan 2011 MCV (Jan 27 Feb 10), cancelled due to cloning 25 Jan 2011 SFV (Jan 25 31), reschedule to Feb ...
Google Analytics Log In: user name temimps@gmail.com password temimps1 Mail from temimps account currently forwarded to: kderr@nysbc.org Set ALLOWTOPICVIEW ...
Transcontinential Initiative for Membrane Protein Structure Meetings Temimps Monthly Meetings TemimpsAnnualMeeting2013 TemimpsAnnualMeeting2012 ...
Current Job Openings at NYSBC Entry level Technician Position in the Cryo Electron Microscopy Facility at the New York Structural Biology Center The Electron Microscopy ...
Contents TEMIMPS members Iban Ubarretxena , Andreas Engel , Pawel Penczek , Tamir Gonen , James Love , David Stokes cc: Changki Kim , Guozhi.Tao@uth.tmc.edu, goragot ...
Schedule for the TEMIMPS Annual Meeting April 10 11, 2012 Tuesday April 10 10:00 David: detergent calculator 10:30 Nicolas: 2dx parameter matrix ...
Contents blank minutes page.doc: template for minutes TEMIMPS PImtg Oct 10 2012.txt TEMIMPS PImtg Sep 4 2012.txt PI Meeting in Washington DC 7/2012 TEMIMPS ...
Annual Report 5/1/2012 Quarterly Report 4/1/2012 Quarterly Report 1/1/2012 Quarterly Report 10/1/2011 Quarterly Report 7/1/2011 Annual Report: May 1, 2011 Quarterly ...
Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...
Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...
TEMIMPS Workshop in Electron Crystallography Lecture Materials August 15 19, 2011 University of Washington School of Medicine, Seattle, Washington Lectures Lecture ...
Contents TEMIMPS Workshop Schedule 2011 Monday Aug. 15 Tuesday Aug. 16 Wednesday Aug. 17 Thursday Aug 18 Friday Aug. 19 0830 Lecture: WelcomeLogistics and Introduction ...
xtracedrop program for characterizing drop shape and quantifying detergent concentrations Contents Program Installation xtracedrop is a python program (xtracedrop ...
New NMR Temperature Calibration Protocol and Correction of old calibration sets Based on Findeisen et al. (Magn. Reson. Chem. 2007; 45: 175–178 findeisen2006 ...
New York Structural Biology Center Sign Up to use the Cryoelectron Microscopy Facility Online Instrument Signup Online EM logbook New User registration: If ...
Workshop in Dual Beam Scanning Electron Microscopy at the New York Structural Biology Center This workshop will introduce the new Helios 650 Nanolab microscope at ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Name: TerryWagenknecht Email: terry@wadsworth.org Company Name: Wadsworth Ctr Company URL: http://www. Location: WadsworthOffice Country: ...
Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW DavidCowburn 22 Jun 2007
DavidCowburn 26 Aug 2008
My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...
Name: Test User Login Name: test1 Email: spam@tspllc.com Phone: Department: Location: (Please specify office location) Comment: ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Name: Themis Lazaridis Email: tl@rilke.sci.ccny.cuny.edu Company Name: CCNY Company URL: http://mingus.sci.ccny.cuny.edu Location: CUNYCCNYOffice ...
Contents Theory Group Meetings concerning Theory/Experiment at NYSBC TheoryExperiment Set ALLOWTOPICVIEW Set GROUP ThemisLazaridis, MarilynGunner ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Thermoshake Program tcontrol.zip Other info (from inheco contact) Attached is the DLL Command Set. you will find the description of the error 16 (No or false Modbus ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Name: ThomasHuber Email: hubert@mail.rockefeller.edu Company Name: Rockefeller University Company URL: Location: RockefellerUOffice Country ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...
Name: Thomas Sakmar Email: sakmar@mail.rockefeller.edu Phone: 212 327 8288 Company Name: RU Company URL: http://www.rockefeller.edu/research/abstract ...
Name: Thomas Sollner RELOCATED TO GERMANY
Name: Thomas Szyperski Email: szypersk@chem.buffalo.edu Company Name: U at Buffalo Company URL: http://www.buffalo.edu Location: SUNYBuffaloOffice ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Visit the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tomography using TVIPS EM Menu 3.0 Contents This Software Is No Longer In Use at NYSBC : Use SerialEM ...
Name: Tieuvi Nguyen Email: tieuvi@gmail.com Company Name: The City College of New York Company URL: http://www. Location: CUNYCCNYOffice Country ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Project proposal : CemProposalTingtingYang09181454 ...
The Office of Research Computing (ORC) aims to provide a state of the art Information Technology platform for all scientific information technology including the acquisition ...
Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW DavidCowburn 26 Nov 2005
http://www.nysbc.net/twiki/bin/view/Main/NysbcDirectory#ToPress
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Name: Tom Muir Email: muirt@rockefeller.edu Company Name: Company URL: http://www.rockefeller.edu/research/abstract.php?id 121 http://www.princeton ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tietz Tomography through EM Menu FEI Tomography software SerialEM tomography software Dual ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
NYSBC Infotech WILL NEVER ASK YOU TO PROVIDE PASSWORD INFORMATION, AND WILL NOT ASK YOU TO OPEN FILES ATTACHED TO EMAILS. PLEASE EXERCISE CARE WITH DECEPTIVE EMAILS ...
Grant Citations: Please remember to acknowledge NIH supported equipment in any submitted manuscripts: http://www.nysbc.net/twiki/bin/view/Main/SupportStatement 700 ...
Please revise these notes after reading the TopSpin 1.3 release letter http://www.nysbc.net/twiki/pub/Main/BrukerSoftwarenews/rellet1 3 ts.pdf Topspin 1.3 installation ...
TMAO reductase (Tor)
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
Tours planned 21 Jul 2010 Wed 9:30A 11:30A Yuying Gosser, Bioinformatics Class, CCNY Macaulay Honors Summer Academy of Math and Science. 1 Aug 2008 ...
Set GROUP DavidCowburn, MichaelGoger, JamesLove, KdDerr, RubenDiaz, JamesLove
Townley, R, Shapiro, L. Crystal Structures of the Adenylate Sensor from Fission Yeast AMP Activated Protein Kinase. Science 315 : 1726 1729 The 5’ AMP (adenosine ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Name: Tracy Godfrey Email : tracy (at) wadsworth.org Company Name: Company URL: Location: WadsworthOffice Country: USA Comment: ...
My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW MarienaSilvestry 21 May 2012
Primer for use of TWiki for scheduling etc Make/Change an entry to any TWiki page TWiki pages can be edited by all registered users Click on "Edit" button ...
Accessing the pages on the NYSBC Intranet web by those external to the Member Institutions. If you are using a computer on the networks of the Member Institutions ...
2dx Crystallization experiments set at NYU Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW NicolasCoudray 14 Jul 2014 Most recent ...
2D crystallization database Data mining from a recent review by Abeyrathne et al., which tabulated successful 2D crystallization experiments from the literature, allowed ...
2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...
2dx Controls X368 Controls in new 3D printed plate (square chambers) frozen protein tested: yiiP (Salvatore), yiiP (John), CysZ, Bor1p, YetJ, BAT14 Set in 3D printed ...
2dx group Monthly calendar 25 Dec 2013 Christmas 22 Nov 2013 Thanksgiving 12 Nov 2013 Veteran's Day 8 Oct 2013 Columbus Day ...
2dx APB 2D crystallization Contents Properties Amino acid sequence: MKSESMAQLNMMLIFLIANVMALLLFPVYGIYEGGLGEEGSNPWVAVYYLIYVIAVTLLIIYIAKKGKKNLLRGIFYFAIAWAMWYALFPLFYYFAIPYSDLISLGLSIVITIGLIKYPEWYMVNFVGILTTVGVALIFGLSLTLLPIIILLSLFAIYDSVAVYMSKHMVYLADSVIEHKLPAMFVMPAKKDYSFKKAKGKPVRKGGEREAYYMGYGDVLIPGILVVAAERNFGMLAGIFTLLGALAAMLLLFVMVNTGKPQPGLPYLNAGALAGLIIFLLI ...
2dx AgrC 2D crystallization Contents Properties Amino acid sequence: MELLNSYNFVLFVLTQMILMFTIPAIISGIKYSKLDYFFIIGISTLSLFLFKMFDSASLIILTSFIIIMYFVKIKWYSILLIMTSQIILYCANYMYIVIYAYITKISDSIFVIFPSFFVVYVTISILFSYIINRVLKKISTPYLILNKGFLIVISTILLLTFSLFFFYSQINSDEAKVIRQYSFIFIGITIFLSILTFVISQFLLKEMKYKRNQEEIETYYEYTLKIEAINNEMRKFRHDYVNILTTLSEYIREDDMIGLRAYFNKNIVPMKDNLQMNAIKLNGIENLKVREIKGLITAKILRAQEMNIPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESENSVTFIVMNKCADDIPRIHELFQESFSTKGEGRGLGLSTLKEIADNADNVLLDTIIENGFFIQKVEIINN ...
2dx CD47 2D crystallization Info Protein from Ravi Human membrane proteins for 2D crystallization trial, CD47. It is stable during expression and purification from ...
2dx Claudin 15: 2D crystallization General 2dx information the protein can be frozen (still leads to 3D crystals) stable at 4C for 2 weeks at least ...
2dx CysZ Pseudomonas aeruginosa Transporter 2D crystallization Info 2 stains: PA01 and PA7 The first aeruginosa is Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 ...
2dx CysZ Pseudomonas fragi Transporter 2D crystallization X380 (November 2015). 8 samples 8 samples: sample Solubilization Purification Dialysis Gel ...
2dx EmrE (Lactobacillus plantarum) 2D crystallization trials Properties Amino acid sequence without tag: M T W I Y L I I G G L F E V V W A T M M K L S N G F ...
2dx gluconate transporter / permease; 2D crystallization Properties Amino acid sequence: MTPLDIQLLLTALASVLVLVALIVSRLKMHPLLALLVVSIGVGFATHMAPGSIVSHLLTGAGKTLGAVGVVIALGAMLGKILADAGVTEQVADVILKRTPDRMIPWAMMLVAFVIGIPMFFEVGLVIMLPLIFSVARKLESKARFKGSAYVYVGVPVISALAAMHGMVPPHPGPLTAIAVLKTSVGPTMLYGFLAAIPAMILGGPLYGMFISPRMNTRPDQALLDQFTLAEKADGQPRPGVMVGMLAALLPAILMLVHAVAEMLLPKGNALLEMASFLGNPLIAMLLGVLFAGASLVLARGGDAEQLRDALGKSLKPIASIIMIIAGGGAFQEMLTSAKVGDAIVHLTQQSAFPPLILGWLIAMLLSVSTGSATVGIVGAAGLLAPLAGADPSLNLPLLALSIGCGSLFFNYANHAGFWMVKESFGMTMGEATKTISVVQSIVAVVGLMVVLMLNAAITIG ...
2dx 2D crystallization trials of GtrB Properties Amino acid sequence: HHHHHHSSGVDLGTENLYFQSNATIELSIVIPMYNEEDNLEHLFARLLEVLTPLKITYEIICVNDGSKDKTLKQLIDCYQSNRQIKIVNLSRNFGKEIALSAGIDYAQGNAVIPIDADLQDPPELIHELVDKWREGYDIVYATRRSRQGETWVKQFTAKMFYKVIGRMTEIKIPPNTGDFRLMDRKVVNAIKQLPERTRFMKGLFAWVGYRQTFVLFDREPRFQGQTKWNYWKLWNFALDGIFSFSLLPLKVWTYLGSIISLLSLAYASFLILKTITLGVDVPGYASLMVAILFLGGVQLISLGVIGEYLGRVYEEVKARPLYLVSDLWGLEYLPLEKLN ...
2dx Kdp 2D crystallization Properties December 19, 2013 3 fractions from 2 frozen samples received: Kdp His: F8 (0.84 mg/ml), F9 (0.99 mg/ml), F10 (0.99mg/ml ...
2dx MDR 2D crystallization General 2dx information Amino acid sequence: MQRIIQFFSQRATTLFFPMALILYDFAAYLTTDLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGALIFTLACAATLLTTSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMGLLALCGLLLAMPETVQRGAVPFSAVSVLRDFRNVFRNPIFLTGAATLSLSYIPMMSWVAVSPVILIDAGGMSTSQFAWAQVPVFGAVIVANMIVVRLVKDPTRPRFIWRAVPIQLSGLATLLLGNLLLPHVWLWSVLGTSLYAFGIGMIFPTLFRFTLFSNNLPKGTVSASLNMVILTVMAVSVEVGRWLWFHGGRLPFHLLAAVAGVIVVFTLATLLQRVRQHEAAELAAEK ...
NYSBC Robot for automated sample insertion (John Henry) Robot/Leginon Startup Guide Robot/Leginon Technical Guide Robot General Guide Robot/Leginon ...
Calibration and Parameter setting of 2DX Robot Vacuum set points vacuum set points for insertion and extraction are contained in the file ~/robot software/robot ...
Robot Design Manuscript Set ALLOWTOPICVIEW DavidStokes 26 Sep 2009 Fig1.ai: fig 1 Fig2.ai: fig 2 Fig3.ai: fig 3 figure 4.ai: fig 4 Fig 5 ...
(15.4; 688.1; 0.1) Robot Manuals (leave this at the top) Controller manual RCX142 e.pdf: rcx142 manual (this is most useful) RCX143 144 e 0322 v1.02.pdf ...
Screening Results Manuscript Set ALLOWTOPICVIEW DavidStokes 26 Sep 2009 figure1.ai: fig 1 figure 2.ai: fig 2 fig 3.ai: fig 3 fig 4.ai: fig ...
2dx SoPIP 2D crystallization General Information Amino acid chain (A mutant) MGHHHHHHSSGVDLGTENLYFQSSMWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWP QALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQL ...
Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...
Contents TwodxYiip TwodxYjbB TwodxZitB TwodxCryoLogBook CryoBor1p CryoCysZfragi Set ALLOWTOPICVIEW Set ALLOWTOPICVIEW ...
2dx UMA 2D crystallization Properties Amino acid sequence: MKLRLTDLAGPVGMGIFMLVVQILSLLLVAPLTDYYDLKAFENPQSVWNPVFYIVLIILFSAVLLLIIKFNMKWIIQLFMIFAVFSTLIYVLFGMGTMLLPPPQYGWEIILAASIIISILLTALMVVYPEWYIVDAVGIMVAAGASALFGISLSVIPTIILLVLLAVYDFIAVYKTKHMIKLAEGVMDLKLPILFVLPRKLSYSYVRSRTQKLEPGKEREAYFMGLGDAVMPTVLAVSASAFLEAPKVLGFANVPAIGVILGTLVSYAVLMYFVMKGKPQAGLPFLCTGAIAGFLLGCLAAGINPFF ...
2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...
2dx YjbB 2D crystallization Properties MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSRSVEKKPLAFCAGIGVTALVQSSNATTMLVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDLSWLSPLLIFIGVIFFLGRKQSRAGQLGRVGIGLGLI ...
2dx UMA mutant 2d crystallization Mutant of UMA. X209 Lipids at MSSM The UMA triple mutant solubilized in detergent 1% DDM and then Ni NTA purification was in ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents Name of the topic Sublevel topic subsub level topic STI 571 Imatinib Gleevec Novartis Abl, cKir, PDGFR CML App May 2001 SU11248 ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Number of topics: 150
Edit | WYSIWYG | Attach | Printable | Raw View | Backlinks: Web, All Webs | History: %REVISIONS% | More topic actions
 
TWiki home
Copyright © by the contributing authors. All material on this collaboration platform is the property of the contributing authors.
Ideas, requests, problems regarding this intranet, Send feedback