topicbacklinks Backlinks to TorS in Main Web   Search all webs

Results from Main web retrieved at 21:41 (Local)

Name Option Tooltip message Graduate Student Graduate Student Student enrolled in your institution for Masters or Doctoral programs Postdoctoral ...
List AllHoursList OPERATIONS OUTSIDE NORMAL WORKING HOURS All hours access. 1.Purpose and General Comments 1 Purpose. The resources of NYSBC need to be ...
Name: Aneel Aggarwal Email: Aneel.Aggarwal@mssm.edu Company Name: MSSM Company URL: http://atlas.physbio.mssm.edu/~aagroup/ Location: MSSM ...
Name: Arthur Palmer Email: agp@nysbc.org Company Name: Columbia Univ. Medical Center Company URL: http://www.palmer.hs.columbia.edu Location: ColumbiaMedCenterOffice ...
Contents Course Syllabus CHEMISTRY 86905 Magnetic Resonance Spectroscopy Spring or Fall 2013 Type Time Days Where Date Range Class 4:05 pm ...
Name: Bruce Merrifield Company Name: Rockefeller Univ. Company URL: http://www.rockefeller.edu Location: RockefellerUOffice Country: USA Comment ...
Contents Administration logs Jan 2011 Set up and installed new computer, cem15 CentOS 5.5, RAID5, 5.2 TB disk All standard EM software installed ...
Contact us: Please send all general inquiries to: cem@nysbc.org. Location: New York Structural Biology Center: 89 Convent Ave, New York, NY 10027 Phone: (212) 939 ...
Contact us: Please send all general inquiries to: cem@nysbc.org. Location: New York Structural Biology Center: 89 Convent Ave, New York, NY 10027 Phone: (212) 939 ...
Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered at NYSBC Fall 2005 Description: A comprehensive course in the theory and practice of ...
Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" Dec 6 ...
Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" Dec. 5 ...
Contents Dec 9 Visualization, Interpretation and Docking (Hernando Sosa) Lecture Presentation lecture dec9.mp3: audio of Dec 9 lecture Dec 2 Digital ...
Overview Detailed Syllabus: Jan 11 : Introduction SEMC tour Welcome to the Simons Electron Microscopy Center and explanation of the course. A tour of NYSBC and ...
Cryoelectron Microscopy of Macromolecular Assemblies 2005 NYU course G16.2617001 Call #30137 3 credits Contents Instructors David Stokes: stokes@saturn ...
Cryoelectron Microscopy of Macromolecular Assemblies 2006 NYU course # G16.4408 3 credits Contents Instructors David Stokes: stokes@saturn.med.nyu.edu ...
Cryoelectron Microscopy of Macromolecular Assemblies 2007 NYU course # G16.4408 3 credits for lectures, 1 credit for practicals credit also available at other ...
Cryoelectron Microscopy of Macromolecular Assemblies 2008 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...
Cryoelectron Microscopy of Macromolecular Assemblies 2009 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...
Cryoelectron Microscopy of Macromolecular Assemblies 2010 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...
Contents Instructors DavidStokes: stokes@saturn.med.nyu.edu BillRice: rice@nysbc.org IbanUbarretxena: iu@sci.ccny.cuny.edu HernandoJoseSosa: hsosa ...
Signup for Discussion sessions of Cryoelectron Microscopy Class Please edit this page and check Discussion Session that you would like to present Then hit save ...
Dual Beam SEM Information CemDualBeamInvestigators FibTests Set ALLOWTOPICVIEW DavidStokes 06 Apr 2009
Investigators interested in using the Dual Beam SEM Dave Hall/Scott Emmons hall@aecom.yu.edu, emmons@aecom.yu.edu (718 430 3130) Hall: biosketch, othersupport ...
Contents EMAN Refinement Files needed threed.0a.mrc the strating model, perhaps produced by common lines start.hed, start.img the particle stack ...
Contents Fei Helios Instructions Sample prep Samples come in resin blocks Trim block size These generally need to be trimmed to ~1cm height so they will ...
TECHNOLOGY / INVENTION DISCLOSURE FORM If you used a pro microinjection technique to create a transgenic animal, please check this box. If your technology includes ...
Dear Committee members, Exciting things are happening at NYSBC. Really. About 10 trucks of concrete were here last week and left us with footings for the new building ...
CryoEM Administration Cowburn's email list June 11,2004: cowburn science email.txt See also DGmailList NYU email lists (moderated) postdoc@lists ...
CEMFacGroup Page CEM Administration Page CemChillerWaterLevels CEM Equipment Maintenance Maintenance Checklist Monthly Task Subtask Location ...
Contents Maintenance Checklist 2013 Task Subtask Location Category Date(1) Date(2) Date(3) Date(4) Date(5) Date(6) Date(7) Date ...
CEMFacGroup Page CEM Administration Page 2014 Archive of CemMaintenance 2013 Archive of CemMaintenance CEM Equipment Mainenance Maintenance Checklist Monthly ...
Contents General Questions Question: I have a protein and want to do EM, what do I do? If you have a protein or a protein complex that has a MW ~300kDa ...
Cryo Electron Microscopy Information and Instructions Visit the Cryo EM Web site at http://www.nysbc.org/facilities/CEM Contents wavelengths 80kV: 0.04176 ...
Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Principles Negative Staining Jump to Protocol Why Negative stain ...
Published work using the NYSBC Cryo EM Facility. Examples of work done at the NYSBC List of Publications Examples of work done at the NYSBC     ...
Contents Reconstruction by Random Conical Tilt Principals For a very good description, see Frank (2006) Three Dimensional Electron Microscopy of Macromolecular ...
Contents NYSBC Policy and Protocol for Remote Access to CEM Computers. CemRemoteoperationRequest NYSBC is offering capability to remotely access CEM Computers ...
Courses and Seminars related to !CryoEM At the NYSBC CEM User meeting and Annual BBQ Event: CEM user meeting Location: NYSBC, Room A 11 Time: Friday, August 22, ...
(Archive)Courses and Seminars related to !CryoEM 2013 At the NYSBC Semester long Course : "Cryoelectron Microscopy of Macromolecular Assemblies" This comprehensive ...
Contents Ongoing issues Tecnai New apertures installed March 6 2015 Objective: 100 um, 50 um, 50 um, 40 um condenser: 150 um, 100 um, 70 um, 50 um BUT third ...
Primer for use of TWiki for CEM scheduling Make/Change an entry to any TWiki page TWiki pages can be edited by all registered users Click on "Edit" button ...
CEMUserhandbook ver1.pdf: CEM User Handbook version 1.00 EM User Handbook Note: Policies may have been updated since this handbook has been completed so please contact ...
Parking There is intense pressure on CCNY's parking lot at 133rd St. Now, this will continue with CCNY's own construction projects. NYSBC cannot offer parking ...
2012 Bhate, MP; McDermott, AE (2012) Protonation state of E71 in KcsA and its role for channel collapse and inactivation. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES ...
Contents Audio solution for conference room What we want We would like to set up a course to be broadcast over the internet to users in Albany. In order to do this ...
2012 Piserchio, A; Francis, DM; Koveal, D; Dalby, KN; Page, R; Peti, W; Ghose, R (2012) Docking Interactions of Hematopoietic Tyrosine Phosphatase with MAP Kinases ...
Current Announcements Pages with additional details specifically for PIs NMR Users EM Users Beam line Users External events Meta Group ...
Contents Current Collaborators and other Affiliations for David Cowburn Persons The following are current collaborators or co authors of the last five years, ...
Name: David Cowburn Login Name: cowburn Email: david.cowburn@einsteinmed.edu Location: Einstein Address: DavidCowburnAddress Einstein Web ...
Name: David Stokes Email: stokes@nyu.edu Company Name: NYU Company URL: http://stokeslab.med.nyu.edu Location: Skirball Institute 3 13 Country ...
Surface tension measurement to determine detergent concentration in a solution; tool description Background The propensity of detergents to alter the surface properties ...
DNP SSNMR Spectrometer for Protein Structural Studies We propose the purchase of a Dynamic Nuclear Polarization (DNP) Solid State NMR (SSNMR) spectrometer at 600 ...
NYSBC currently offers the following semester long, graduate level course, which are fully accredited. The courses are held at NYSBC. "NMR Spectroscopy of Macromolecules ...
2018 Hayama, R., Sparks, S., Hecht, L.M., Dutta, K., Karp, J.M., Cabana, C.M., Rout, M.P., and Cowburn, D. (2018). Thermodynamic characterization of the multivalent ...
EM Imaging Processing GUI EMIP EMIP is a Graphical User Interface written in wxPython that collects information from the user and runs existing programs from ...
Q A What happened to the proposal? As of 21 May, it is accepted at NIH and assigned to a special study section. The initial peer review should be completed ...
MATERIALS REAGENTS Ampicillin or carbenicillin Plasmid pRSF.1b (Novagen), containing the cDNA for the protein M9 medium (see REAGENT SETUP) ...
Contents Previous announcements may be available in the revision history of this page. Announcements etc of jobs other than directly in NYSBC NMR jobs no longer ...
Contents Filament Exchange Determining if the filament is blown You had a beam, but now you do not. You did not move the sample or change any ...
How to Plot 1D CTF profile of an image This can now be done more simply using EmIP Contents Setup Linux computer login startx depth 8 cd /dl380 ...
Information for the General Public about the New York Structural Biology Center page in preparation What we do The New York Structural Biology Center operates high ...
Information for Scientists about the New York Structural Biology Center General For Principal Investigators at the Institutions NYSBC uses an extensive intranet ...
Contents Foreign Visitors Programs at NYSBC Distinguished Visitors Faculty with established programs, outside the US, related to NYSBC activities may be considered ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
NEW YORK STRUCTURAL BIOLOGY CENTER POLICIES Printable version of this file. (pdf format) COMPUTER ELECTRONIC COMMUNICATIONS POLICY The Center’s policy on the ...
Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...
Name: Hao Wu Email: haowu@med.cornell.edu Company Name: WMCCU Company URL: http://www.med.cornell.edu Location: WMCCU Country: USA Comment ...
Contents Helical Processing : Initial steps display tube image and transform mrcdisp to display hft to calculate fft (must create id.box file with box ...
Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Helical Reconstruction using EMIP This protocol uses software that originated ...
Contents Papers with high citation statistics associated with NYSBC investigators NMR/ Structural Biology Based on an ISI search using the terms "NMR AND (protein ...
Contents How To (for Principal Investigators) ... How to get documents to support my grant applications The following are generally available A general ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
You can add to this page as incidents reported changes NB this is a Main Web page readable by all. For staff comments, use IncidentReports On mar 5 1100P, drove ...
Inclusion of Women And Minorities in Clinical Research: It is the policy of the NIH that women and members of minority groups and their sub populations must be included ...
Infotech Group , NYSBC The TSP contractors in the InfotechGroup manage the computer systems at NYSBC. They are responsible for Internal network management ...
Content Integrative approached to multidomain protein structure. 1 Using standard NMR methods to compare individual and multiple domains. Gosser, Yuying Q. ...
TIME PERSON TITLE REFERENCE PAPERS 1030 1045 Cowburn Enhancing the Interface 1045 1130 Jie Zheng, St. Judes Structure based Investigation ...
My Project Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...
Room 118 LogBook; experiments, debugging and updating... Manual use of 1230 1. Check the robot is not running (Leginon would appear and run on the main screen ...
JEOL 2100 Instructions Visit the Cryo EM Web site at http://www.nysbc.org/facilities/CEM K2 Camera Regular Maintenance Anneal cycle should be run weekly ...
Structure based Investigation of Wnt Signaling Inhibitors Jie Zheng Department of Structural Biology, St. Jude Children's Research Hospital, Memphis, TN 38105 ...
Name: Joachim Frank Email: tb2319@columbia.edu Company Name: Columbia Office Company URL: Location: ColumbiaMedCenterOffice Country: USA ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents KITCHEN ETIQUETTE Introduction NYSBC welcomes its affiliate members to its facilities and wishes that they and the NYSBC staff have a productive and stimulating ...
Contents MDS from Scratch Set up microscope: Condensor lens inserted and centred Objective lens inserted and centred Set up Search mode ...
Contents Maintenance Instructions for 14 day tasks Week A Vacuum F20 and 1230 rooms Regrease O rings and clean All Microscope Holders Only Use Fomblin Grease ...
Name: Mark Girvin Email: mark.girvin@einstein.yu.edu Company Name: Albert Einstein College of Medicine Company URL: http://www.bioc.aecom.yu.edu/labs ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
Automation of jeol1230 with iRobot, Leginon and Animated TEM Contents Startup User manual to use Leginon combined with the Matlab nodes associated to the Animated ...
META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq 2015 ...
META GROUP MEETINGS #8211; NYSBC Held in A 11 Park Building NEXT MEETING ... We would like to provide each participating group the opportunity to conduct ...
2007 Calendar Year DATE EVENT 25 Jan 2007 THURSDAY NOON VISITOR SEMINAR, Dr. Chiara Pastore, NIMR London, 'Insights into Iron Sulphur cluster ...
META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq 2008 ...
Premier Publication Following are the guidelines used by crystallographic structural biology at NSLS ... "A publication is considered premier if the journal has an ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Tests of the micro dialysis plates performances Reference See MicroDialysisPlatesTool for an overview and information about the protocol. Experiments; test of the ...
Contents Kent Notes indicators of good freeze smooth membranes round organelles indicators of bad freeze Echlin Book has good ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
2011 Borah, J. C., Mujtaba, S., Karakikes, I., Zeng, L., Muller, M., Patel, J., Moshkina, N., Morohashi, K., Zhang, W. J., Gerona Navarro, G., Hajjar, R. J., and Zhou ...
Outline of points from RFA Aims Quantitative characterization of machinery inside living cells that underlies cell function and regulation Engineer molecular ...
Contents Information for Principal Investigators new to NYSBC This page summarizes some specific information for PI's newly affiliated with NYSBC. There's a general ...
Contents New User Setup Tecnai F20 Create new accounts on both computers and Greymatter Set passwords to never expire Windows 2000 or XP ...
My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...
Contents COURSE ANNOUNCEMENT Title: Biochemistry GR6270 NMR Spectroscopy of Macromolecules Instructors: Arthur G. Palmer Department of Biochemistry and Molecular ...
Contents Nmr Proteomics List NESG This is the html version of the file http://www.nesg.org/docs/NESG2.1.doc. Northeast Structural Genomics Consortium ...
Requests for DNP spectrometer time can submitted at DnpNmrSchedule The availability of 750 and 900 MHz Solid state probes can be found at SolidsProbestatus ...
Q A How do people enter the system to get NMR time? 1. Principal Investigators can ask for their institution's time to be allocated to them by contacting their ...
Contents I have a detailed operational question. See NmropFAQs I have a generic NMR question, not specific to NYSBC See NMR Wiki What is NMR? Nmr For the ...
Contents NYCOMPS WebHome Partipant Investigators 1 MarkGirvin 1 WayneHendrickson 2 AnnMcDermott 2 LawrenceShapiro 3 Burkhard Rost 3 ...
Contents Visitors !! We welcome everyone at the public seminars and meetings at NYSBC. Those formally affiliated with the Center are welcome during all ...
Contents General Introduction for New Affiliates at NYSBC Your safety. Human safety is everyones' daily concern at NYSBC. Laboratory Environment and Safety ...
Contents NEW YORK STRUCTURAL BIOLOGY CENTER LOCATION AND ACCESS Note that NYSBC has its principal operations at 133rd St and Convent Avenue in Manhattan, described ...
Contents RESOURCES (NYSBC GENERAL LABORATORIES, NIH style format, the individual sections can be copied and pasted ) FACILITIES: Specify the facilities ...
Poster judges 1 Please score as many of the posters as you can comfortably do in the lunch period, probably 10 is reasonable. 2 Use the NIH like scale 1(best ...
  Summer 2013 Meeting 9:00 5:30 pm, Monday, 5th Aug, 2013, at Mount Sinai School of Medicine, Annenburg Stern Auditorium, 1468 Madison Avenue (at E. 101st Street ...
Summer Meeting 2013, Mount Sinai School of Medicine Helen Berman, Rutgers Univ. Structural Biology Data and Information Resources: New Features and Functionalities ...
New York Structural Biology Discussion Group Logistical Arrangements for Hunter School of Health Sciences vendor contacts: Kessler A J liquors 212 685 7651 at 28th ...
Contents Summary of the 2013 Winter Meeting Program Confirmed Speakers Aneel Aggarwal, Mount Sinai School of Medicine "DNA Protein Recognition : Engineering ...
NYU Structural Biology Program Requirements Required Courses Foundations Course I and II (1st and 2nd semester) Principles in Structural Biology (1st semester ...
2011 Ndao, M., Dutta, K., Bromley, K. M., Lakshminarayanan, R., Sun, Z., Rewari, G., Moradian Oldak, J., and Evans, J. S. (2011) Probing the self association, intermolecular ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Contents Densitometer data Startx depth 8 Cd /home/nsfhome/kderr/pds … Change .HDR and .IMG files to lowercase Mv HDR filename.hdr Pds2mrc ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Poget SF, Cahill SM, Girvin ME 'Isotropic Bicelles Stabilize the Functional Form of a Small Multidrug Resistance Pump for NMR Structural Studies.' J Am Chem Soc ...
Contents Power Measurements for 500 Low Power The low power measurements were done with 1GHz oscilloscope via 2m RG241 cable. The high power measurements were done ...
Contents Power Measurements for 600 Low Power Low power measurements: As of 12/8/05 The low power measurements were done with 1GHz oscilloscope via 1m RG241 cable ...
Contents Previous Support, David Cowburn Rational Design of Regulators of Programmed Cell Death in Human Breast Cancer 1 USAMRMC DAMD17 99 1 9363 2 "Rational ...
Contents Protein NMR Course Fall 2018 Compact summary of course, see below for full notes Information about grades for the University admin folks ...
Contents Protein NMR Course NEXT OFFERED Jan 2009 CURRENTLY IN PROGRESS NmrCourse Compact summary of course, see below for full notes Course materials ...
Contents Protein NMR Course Spring 2015 Compact summary of course, see below for full notes Information about grades for the University admin folks ...
Day DATE Module Click on the number for the course material ref. Use MoDall to see all Title Lecturer(s) 1 1 Sept Organizational Meeting Ronnie ...
Contents Syllabus January 29 Organizational Meeting Ronnie Ghose February 5 Introduction to modern NMR – the ...
Contents Syllabus January 29 Organizational Meeting Ronnie Ghose February 5 Introduction to modern NMR – the ...
Notes a !! This publication has two or more Member Institutional affiliations. b !! This publication has NYSBC as an institutional affiliation because ...
For copyright reasons, you will not be able to access articles which are not on PubMedCentral on computers outside the networks of the Member Institutions NYSBC ...
For copyright reasons, you will not be able to access articles which are not on PubMedCentral on computers outside the networks of the Member Institutions NYSBC ...
For copyright reasons, you will not be able to access articles on computers outside the networks of the Member Institutions NYSBC affiliates are welcome to make ...
For copyright reasons, you will not be able to access articles which are not on PubMedCentral on computers outside the networks of the Member Institutions NYSBC ...
For copyright reasons, you will not be able to access articles which are not on PubMedCentral on computers outside the networks of the Member Institutions NYSBC ...
Contents NYSBC Policy and Protocol for Remote Access to Computers. This is a general policy outline. Specific details for operations are available at CemRemoteoperations ...
Name: Ronnie Ghose Email: rghose@sci.ccny.cuny.edu Company Name: CUNY CCNY Company URL: http://www.ccny.cuny.edu http://www.sci.ccny.cuny.edu/~ghose ...
2011 Cho, J. H., Muralidharan, V., Vila Perello, M., Raleigh, D. P., Muir, T. W., and Palmer, A. G. (2011) Tuning protein autoinhibition by domain destabilization ...
Name: Ruth Stark Email: stark@sci.ccny.cuny.edu Company Name: CUNY Company URL: Location:CUNYCCNYOffice Country: USA Comment: Dr. Ruth ...
Contents Structure Calculation in NMR Notes for Round Table Discussion Jan 18 MetaGroup The purpose of this round table is to increase the understanding of the ...
February 2008 Scientific Report, NYSBC See http://www.nysbc.net/twiki/bin/viewfile/Main/ScientificReport?rev 1;filename Feb08ScientificReport.pdf for final pdf ...
Contents June 2007 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...
June 2008 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...
Mar '10 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...
Mid 2009 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...
Nov 2008 Scientific Report, NYSBC Figure contents described on last page. Introduction In order to provide Principal Investigators and ...
Contents September 2007 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of ...
Major features Revision control complete audit trail, also for meta data such as attachments and access control settings. Provides identification of all contributors ...
Name: Seth Darst Email: darst@rockefeller.edu Company Name: Rockefeller University URL: http://www.rockefeller.edu/research/abstract.php?id 32 ...
SPARTA: Shifts Predicted from Analogy in Residue type and Torsion Angle – NYSBC notes As described in the paper: Protein backbone chemical shifts predicted from ...
Contents Shutdown checklist All microscopes 40 kx magnification Spread Beam clockwise to cover screen Close column valves or turn off filament ...
Contents Instructions for processing Single particle crystals 1 Setup directories: mkdir doc mkdir patch mkdir coran mkdir classavg 2 Convert from mrc ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
2009 Kissena Board of Directors PRESIDENT Stacey Jensen VICE PRESIDENT David Stokes TREASURER Eric Ragot SECRETARY Wai Fong SPONSORSHIP ...
This is an updated list of nominations for Kissena Board positions. This update includes new statements from several of the candidates (Eric M., Rufus, Joe, Wai ...
Final Nominations for the 2010 Kissena Board of Directors. Elections will be held by paper ballot at the club party on Dec 6th, 2009 at 7 PM. The location will be ...
Support Statements in papers. Generally... Principal Investigators should acknowledge their use of NYSBC in papers and presentations as below for specific instruments ...
Name: tarun kapoor Email: kapoor@rockefeller.edu Company Name: Rockefeller University Company URL: www.rockefeller.edu Location: RockefellerUOffice ...
Visit the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tecnai F20 (basic operations) TEM data computer controls Fast Scan CCD holds data and provides ...
Current Job Openings at NYSBC Entry level Technician Position in the Cryo Electron Microscopy Facility at the New York Structural Biology Center The Electron Microscopy ...
Contents blank minutes page.doc: template for minutes TEMIMPS PImtg Oct 10 2012.txt TEMIMPS PImtg Sep 4 2012.txt PI Meeting in Washington DC 7/2012 TEMIMPS ...
Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...
The Office of Research Computing (ORC) aims to provide a state of the art Information Technology platform for all scientific information technology including the acquisition ...
Name: Tom Muir Email: muirt@rockefeller.edu Company Name: Company URL: http://www.rockefeller.edu/research/abstract.php?id 121 http://www.princeton ...
Primer for use of TWiki for scheduling etc Make/Change an entry to any TWiki page TWiki pages can be edited by all registered users Click on "Edit" button ...
2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...
(15.4; 688.1; 0.1) Robot Manuals (leave this at the top) Controller manual RCX142 e.pdf: rcx142 manual (this is most useful) RCX143 144 e 0322 v1.02.pdf ...
2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...
Name: Ulrich Hammerling Email: U Hammerling@ski.mskcc.org Company Name: MSKCC Company URL: http://www. Location: MSKCCOffice Country: USA ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...
Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...
Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...
Contents XEASY manual: 3. The XEASY Model previous: 2. Using XEASY / contents 3. The XEASY Model To enable computer supported spectra interpretation, an operational ...
My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...
Number of topics: 184
 
TWiki home
Copyright © by the contributing authors. All material on this collaboration platform is the property of the contributing authors.
Ideas, requests, problems regarding this intranet, Send feedback