1230 Robot checklist Robot 1 turn on gas tank 1 start iRobot and hist "Start" 1 demagnitize grid pickup nozzle 1 clamp grid tray in position 1 place ...

2dx Overview Contents Protocols Computing... crash total computer: ssh from another machine sudo init 3 sudo kill 9 whatever Xorg sudo init ...

AFFILIATION ENDORSEMENT AT NYSBC Your notes Please change this text to indicate any additional information not reflected on the form below ...

NYSBC Affiliation procedure for individual users How To Become Affiliated with NYSBC In order to become Affiliated with NYSBC, you need endorsement from ...

Contents Making Movies in Amira Instructions for version 3.0 (and above?) from David Stokes (created by Wanzhong He) 1 "install" the following scripts ...

Name: Andrea Nans Email: andrea.nans@gmail.com Company Name: New York University Company URL: http://saturn.med.nyu.edu/research/sb/stokeslab/ ...

Name: Andrew Pomfret Email%: Company Name: NYU School of Medicine Company URL: http://saturn.med.nyu.edu/~stokes/ Location: NYUSoMOffice ...

Name: Bill Rice Email: rice@nysbc.org Company Name: Company URL: http://www. Location: ParkBuildingOffice Country: USA Comment: CEM ...

CEM Staff Emergency Contact Name Cell Phone After Hours Email SMS? (Y/N) Bill Rice 917 528 0333 rice@nysbc.org Y David Stokes 646 284 8775 ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Using Carbon Rod in Edwards 306 Jump to Principles THIS ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Using Carbon Thread in Edwards 306 Jump to Principles ...

Name: Carmen Mannella Email: carmen@wadsworth.org Company Name: Wadsworth Company URL: http://www.wadsworth.org Location: WadsworthOffice ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM Taking CCD Image with EMMENU Blank beam Click to expose in Tecnai interface ...

Contents Bench Processed Bench Processed: desm112503 02.jpg: Plunge Frozen in Ethane desmo03.jpg: desmo04.jpg: High Pressure Frozen NYSBC ...

Cryo electron Microscopy (CEM) uses electrons accelerated to almost the speed of light to reveal images of individual molecules and molecular assemblies. The electrons ...

Cryoelectron Microscopy (CEM) uses electrons accelerated to almost the speed of light to reveal images of individual molecules and molecular assemblies. The electrons ...

Procedure for using the CEM facility at the NYSBC The NYSBC The New York Structural Biology Center is a 501 (c)(3) corporation incorporated in the State of New York ...

CEM Administration Contacts CEMStaffEmergencyContact EmergencyCall Staff Procedures Ordering, Shipping and Receiving NYSBC Procedures ...

Policy on Time Allocation for NYSBC Electron Microscopy Facilities For each month, each Member Institution is entitled to a share of the resources proportional ...

CEM Course 2009 2009 Web Site for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" CemCourseAnnouncement09 CemCourseSyllabus09 ...

Cryoelectron Microscopy of Macromolecular Molecules Course 2010 CemCourseAnnouncement10 CemCourseSyllabus10 CemCourseMaterials10 CemPracticalSignup10 ...

CemCourseAnnouncement11 CemCourseSyllabus11 CemCourseMaterials11 CemPracticalSignup11 Student list CemCoursePaperTopics11 Set ALLOWTOPICVIEW ...

Contents CemCourseAnnouncement12 CemCourseSyllabus12 CemCourseMaterials12 CemPracticalSignup12 Student list Set ALLOWTOPICVIEW DavidStokes ...

Contents CemCourseAnnouncement13 CemCourseSyllabus13 CemCourseMaterials13 CemPracticalSignup13 Student list CemCoursePaperTopics13 Set ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 10th year at NYSBC Fall ...

Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered at NYSBC Fall 2005 Description: A comprehensive course in the theory and practice of ...

Download the flier CemCourseAnnounce.pdf: Cryo EM Course flier Set ALLOWTOPICVIEW DavidStokes 01 Aug 2006

Visit the !CryoEM web site at http://www.nysbc.org/facilities/CEM Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 4th year at ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 4th year at NYSBC Fall ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 5th year at NYSBC Fall ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 6th year at NYSBC Fall ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 7th year at NYSBC Fall ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 8th year at NYSBC Fall ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 9th year at NYSBC Fall ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 10th year at NYSBC Fall ...

CEM Course Group Web Site for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" CemCourseAnnouncement CemCourseAnnouncement14 CemCourseSyllabus14 ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" Dec 6 ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" Dec. 5 ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Cryoelectron Microscopy of Macromolecular Assemblies COURSE EVALUATION CEM ...

Contents Dec 9 Visualization, Interpretation and Docking (Hernando Sosa) Lecture Presentation lecture dec9.mp3: audio of Dec 9 lecture Dec 2 Digital ...

Contents Class Evaluation form CEM Course evaluation 2009.doc: Course Evaluation Dec 8 Fitting Hernando Sosa Lecture Presentation Fitting EM12 ...

Contents Dec 7 Molecular Fitting Lecture Presentation sosa2.mp3: audio of lecture on molecular fitting Nov 23 Helical Reconstruction Lecture ...

Contents Dec. 7 Molecular Fitting Willy Wriggers Lecture NYSBC11.ppt: Molecular Fitting PPT Molecular fitting 20111206 2105 1.arf: recording ...

Contents Dec 4 Molecular Fitting Willy Wriggers NYSBC12.ppt: Molecular fitting lecture Wriggers 2012 Molecular Fitting 20121204 2102 1.arf: Molecular ...

Contents Dec 10 Molecular Fitting Wily Wriggers Lecture nysbc13.ppt: powerpoint of molecular fitting lecture wriggers.mp3: audio of molecular ...

Contents Player required for arf video files nbr2player.msi: MS windows player for arf files Lectures Structure Validation and Fitting Dec. 9 Lecture ...

CEM Course Paper Topics Sign up for Paper Topics in the table below: Go to the bottom of this page. Hit the "Edit" link. Enter your name in between ...

CEM Course Paper Topics Final papers are due on Dec 13. Send pdf to stokes@nyu.edu Papers should be no more than 5 pages of text for the body. Figures ...

CEM Course Paper Topics Final papers are due on Dec 11. Send pdf to stokes@nyu.edu Papers should be no more than 5 pages of text for the body. Figures ...

CEM Course Paper Topics Final papers are due on Dec 12. Send pdf to stokes@nyu.edu Papers should be no more than 5 pages of text for the body. Figures ...

CEM Course Paper Topics Final papers are due on Dec 11. Send pdf to stokes@nyu.edu Papers should be about 5 pages of text for the body. Figures should ...

Final papers are due on Dec 13. Send pdf to stokes@nyu.edu Papers should be about 5 pages of text for the body. Figures should be included to illustrate ...

Final papers are due on Dec 20. Send pdf to stokes@nyu.edu Your paper should be about 5 pages of text for the body. Figures should be included to illustrate ...

Attendees name position inst lab email credit reg card disc Ana Asenjo tech AECOM Sosa Lab aasenjo@aecom.yu.edu ...

Attendees name position inst lab email credit disc paper Allyson Bunbury grad stud AECOM Pathology abunbury@aecom.yu ...

Attendees name position inst lab email credit disc paper Erik Debler grad stud Rockefeller Lab Cell Biol edebler@rockefeller ...

Attendees name inst lab email position credit disc paper Kampmann Rockefeller Blobel kampmam@mail.rockefeller.edu grad ...

Students name inst lab email position credit disc paper Yi ying Chou MSSM Palese Yi ying.Chou@mssm.edu grad student (2) ...

Contents CEM Course 2010 Participants Name Email Institution PI Department Credit Roselia Mora rmora@cornell.edu WEIL R. Silver Physiology ...

as3211@columbia.edu, coloma.javi@gmail.com, anna.piasecka@einstein.yu.edu, nathan.will@mssm.edu, jil2014@med.cornell.edu, tchou@stevens.edu, ilonanu0811@gmail.com ...

Contents Student list Name Email Position School credit (yes/no) Thomas Hsiao thsiao@mail.rockefeller.edu Grad Student Rockefeller ...

Contents Name emai l inst PI position credit Keith Hamilton kh2634@columbia.edu COLU Ling Tong Grad Student ...

Cryoelectron Microscopy of Macromolecular Assemblies 2005 NYU course G16.2617001 Call #30137 3 credits Contents Instructors David Stokes: stokes@saturn ...

Cryoelectron Microscopy of Macromolecular Assemblies 2006 NYU course # G16.4408 3 credits Contents Instructors David Stokes: stokes@saturn.med.nyu.edu ...

Cryoelectron Microscopy of Macromolecular Assemblies 2007 NYU course # G16.4408 3 credits for lectures, 1 credit for practicals credit also available at other ...

Cryoelectron Microscopy of Macromolecular Assemblies 2008 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...

Cryoelectron Microscopy of Macromolecular Assemblies 2009 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...

Cryoelectron Microscopy of Macromolecular Assemblies 2010 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...

Contents Instructors DavidStokes: stokes@saturn.med.nyu.edu BillRice: rice@nysbc.org IbanUbarretxena: iu@sci.ccny.cuny.edu HernandoJoseSosa: hsosa ...

Contents Syllabus Intro to EM Optics, image formation and Diffraction Sept 23 David Stokes (NYU/NYSBC) Fourier transforms, CTF, cross correlation Sept 30 ...

Contents List of Samples Carbon Film Gold TMV : single particle helical reconstruction phi6 (Paul Gottlieb) : single particle, icosahedral reconstruction ...

Name Type Size Values Tooltip message Attributes All Dates checkbox 9 10/9, 10/16, 10/23, 10/30, 11/6, 11/13, 11/20, 11/27, 12/4 dates ...

Signup for Discussion sessions of Cryoelectron Microscopy Class Please edit this page and enter your TWiki username next to the Discussion Session that you would ...

Signup for Discussion sessions of Cryoelectron Microscopy Class Please edit this page and enter your TWiki username next to the Discussion Session that you would ...

Dual Beam SEM Information CemDualBeamInvestigators FibTests Set ALLOWTOPICVIEW DavidStokes 06 Apr 2009

Investigators interested in using the Dual Beam SEM Dave Hall/Scott Emmons hall@aecom.yu.edu, emmons@aecom.yu.edu (718 430 3130) Hall: biosketch, othersupport ...

Electron Crystallography Projects Zinc Transport YiiP protein – structural basis for an alternating access model Micrograph of negatively stained YiiP ...

How to install Flash Plugin in 64 bit Linux systems The problem is that the flash plugin is designed for 32 bit and will not run on the 64 bit machines. 1. Get ...

CryoEM Grant Applications TwoDCrystalScreening NanoMedicine NIH Electron Grant Application Process CemDualBeam Visit Cryo EM website at http://www ...

Notes on Compiling and Using Helical Reconstruction Programs from Toyoshima Lab Migration to Unwin software hfts was modified to add zorg to parameter list for ...

IT resources at the CEMfac List of supported SoftWare EmIP GUI for image processing Tomography MontageNavigator hints on using the Navigator in SerialEM ...

IT resources at the CEMfac TemimpsTwikiToWebList add TWiki pages to TEMIMPS web site CemTwikiToWebList add TWiki pages to public web site CemTwikiToWebListTest ...

TECHNOLOGY / INVENTION DISCLOSURE FORM If you used a pro microinjection technique to create a transgenic animal, please check this box. If your technology includes ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM !CryoEM facility at NY Structural Biology Center CapabilitiesCEM.doc: MS Word version CapabilitiesCEM ...

Dear Committee members, Further to my last message, I am attaching the documents recently sent to our two potential vendors requesting their Best and Final Offers ...

Dear Committee members, Exciting things are happening at NYSBC. Really. About 10 trucks of concrete were here last week and left us with footings for the new building ...

CryoEM Administration Cowburn's email list June 11,2004: cowburn science email.txt See also DGmailList NYU email lists (moderated) postdoc@lists ...

CEM Microscope Schedule Please Use the New Scheduler If you do not have an account, email emg@nysbc.org Temporary EM Microscope Requests http://emg.nysbc ...

Name Type Size Values Tooltip message Attributes Abbondanziere, E radio 7 none, Steve, David, Da Neng, Joel, Dan, Tom Abbondanziere ...

Name Type Size Values Tooltip message Attributes Abbondanziere, E reviewer select 1 none, Steve, David, Da Neng, Joel, Dan, Tom ...

Request Page for NYU Users This page is for requesting pre allocated EM time slots, which are indicated on CemMicroscopeSchedule you may read rules for how booking ...

Visit the !CryoEM web site at http://www.nysbc.org/facilities/CEM Cryo EM Operations Committee Members Your representative from the !CryoEM Operations Committee ...

Visit the !CryoEM web site at http://www.nysbc.org/facilities/CEM Cryo EM Operations Committee Members Your representative from the !CryoEM Operations Committee ...

Name Type Size Values Tooltip message Attributes All Dates checkbox 11 9/20, 9/27, 10/4, 10/11, 10/18, 10/25, 11/1, 11/8, 11/15, 11/22 ...

Signup list for practicals Please add your name to the table so we can get an idea of how many will be attending the practicals (week of Nov. 2). Table Name ...

Name Type Size Values Tooltip message Attributes Title of Project text 60 enter a title PI of Lab text 40 specify ...

Welcome to NYSBC We have received your proposal for using the electron microscope facility at NYSBC. If you have not already discussed this project with one of the ...

Reading and setting robot coordinates in robot controllers Manual robot control and hand controller operation using iRobot to manually control robot movement ...

Contents Leginon/Robot Technical Guide Minghui robot tech guide.doc: Robot Technical Guide (MS Word format) Leginon Update As of Feb 2010, Leginon is under major ...

Contents User Guide for Robot/Leginon on JEOL 1230 Minghui Hu Friday, February 26, 2010 Minghui Leginon setup guide.doc: MS Word version PC access abc123 Checklists ...

Contents Camera Webpages http://192.168.5.160 http://192.168.5.166 Automated Control and Robotics on 1230 Options for Automated Control ...

Overview of EM Scheduling at NYSBC Time on our 200kV electron microscopes is allocated per institution according the calendar shown on CemMicroscopeSchedule. Each ...

Courses and Seminars related to !CryoEM At the NYSBC CEM User meeting and Annual BBQ Event: CEM user meeting Location: NYSBC, Room A 11 Time: Friday, August 22, ...

(Archive)Courses and Seminars related to !CryoEM 2013 At the NYSBC Semester long Course : "Cryoelectron Microscopy of Macromolecular Assemblies" This comprehensive ...

Procedure for using the CEM facility at the NYSBC The NYSBC The New York Structural Biology Center is a 501 (c)(3) corporation incorporated in the State of New York ...

Procedure for using the CEM facility at the NYSBC The NYSBC The New York Structural Biology Center is a 501 (c)(3) corporation incorporated in the State of New York ...

Contents CEM Signup Rules 1 Bill Rice is the administrator for the booking software (rice@nysbc.org). 1 Signups open at noon on Monday for the following week ...

Contents Initial Setup need following packages: Apache, subversion, mod dav svn (install with yum) configuration edit /etc/httpd/conf.d/subversion.conf ...

Primer for use of TWiki for CEM scheduling Make/Change an entry to any TWiki page TWiki pages can be edited by all registered users Click on "Edit" button ...

CEMUserhandbook ver1.pdf: CEM User Handbook version 1.00 EM User Handbook Note: Policies may have been updated since this handbook has been completed so please contact ...

Welcome to the CEM home page SAFETY at NYSBC CEM Newsletter EM Related Seminars and Courses New EMG sites Leginon / Appion EMG site New scheduler ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Computer Processing File conversion, Fourier transformation, and plot CTF Visit Cryo EM Web site at http://www.nysbc.org/facilities/CEM DavidStokes 18 Mar 2005 ...

Contents Consortium Course Issues for the Member Institutions NYSBC is not a degree granting institution, so all associated courses are run as part of the Member ...

Contents CEM construction contingency plan General information CUNY will build a new laboratory building adjacent to the NYSBC. Although the plan was for the construction ...

CryoEM course evaluations Thank you for attending the course and thank you for submitting an evaluation. It will help us improve the course for next year. We ...

Current schedules of seminars and other public meetings related to Structural Biology for NYSBC. Please be advised that NYSBC web pages are the latest information ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Cryo Electron Microscopy Information and Instructions General Proper Handling of Cold Stages ...

Equipment for Sample Preparation Sample Preparation for Cryo EM Equipment BOC Edwards Vacuum Evaporator HighPressFreezer PlungeFreezing Freeze ...

CryoUltraMicrotomy Microtome Conversion Cryosectioning notes from Chyongere Hirsch (Wadsworth Center Albany,NY)24 Mar 05 Visit the Cryo EM Web site at ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Customise this topic; samples and ideas available at TWiki:TWiki.WebLeftBarCookbook. DavidStokes CemfacGroup CemAdmin CemProjects Reimbursement ...

Contents Overview Detergents is a program that analyzes the composition of ternary mixtures of detergent, lipid and protein. These mixtures represent the starting ...

NYSBC currently offers the following semester long, graduate level course, which are fully accredited. The courses are held at NYSBC. "NMR Spectroscopy of Macromolecules ...

Contents C. Elegans Pharynx New Piston Seal Gut1.jpg: Gut2.jpg: After Piston Assembly Replacement Pharynx.jpg: Set ALLOWTOPICVIEW ...

EM Imaging Processing GUI EMIP EMIP is a Graphical User Interface written in wxPython that collects information from the user and runs existing programs from ...

Contents Installation and Updating of EMAN2 Download and untar the latest release from http://blake.bcm.edu/emanwiki/EMAN2/Install/BinaryInstall go to installation ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tecnai Tomography Contents This Software Is NO LONGER IN USE at NYSBC: Use SerialEM Microscope ...

How to Plot 1D CTF profile of an image This can now be done more simply using EmIP Contents Setup Linux computer login startx depth 8 cd /dl380 ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM Taking a film image Insert small screen adjust brightness until the exposure meter reads ...

Screening and Scanning EM Film Instructions for PDS 1010GM Microdensitometer Instructions for PDS 1010GM Data Processing Instructions for Zeiss Photoscan ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Principles Freeze Substitution Jump to Protocol Important considerations ...

Contents Automated Control and Robotics on 1230 Options for Automated Control SerialEM already installed, but does not fully work because of emulator ...

Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...

Contents Kdp plot defocus values for individual images from each dataset (df vs. tilt angle) motif averaging of David's and Guobin's data (maybe later ...

Application for Dual Beam SEM for HEI program S10 SEM nih compiled grant.pdf: NYU S 10 SEM grant Set ALLOWTOPICVIEW DavidStokes 04 Apr 2009

Contents Helical Processing : Initial steps display tube image and transform mrcdisp to display hft to calculate fft (must create id.box file with box ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Helical Reconstruction using EMIP This protocol uses software that originated ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols High Pressure Freezing Jump to Principles Equipment Instructions ...

Contents Grids to use as spacers Ted Pella grid catalog number Avg. thickness (microns) Range (microns) 9GC20H "Chien" 27 ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Using the Bal Tec High Pressure Freezer Jump to Principles ...

Image Processing FilmScreeningAndScanning EMIP DetergentCalculator HelicalReconstruction Set ALLOWTOPICVIEW DavidStokes 31 Dec 2008

Infotech Group , NYSBC The TSP contractors in the InfotechGroup manage the computer systems at NYSBC. They are responsible for Internal network management ...

Return to Cryo EM Website at http://www.nysbc.org/facilities/CEM Cryo sample loading Contents Apertures Condenser aperture #2 Objective aperture #4 Check ...

Return to Cryo EM Website at http://www.nysbc.org/facilities/CEM Insert sample Open Vacuum Overview page Prepump Airlock Line up pin on holder ...

Contents Prerequisites 1 python 1 gtk and glib. If the FSU software has been installed already then the required libraries should already be present 1 wxGTK ...

Contents JEOL 3200 training 3200 training notes.doc: DLS notes on 3200 training Cryogen fill Chuck dewar Fill in morning and last thing at night ...

Booting into Linux using Knoppix Live CD Download the above file and burn it as a CD image. Reboot your computer, choosing this CD as the boot device. This will ...

Laboratory Safety and Environment Committee Pages See LabSafetyEnv for the public documents nysbc laboratory safety links LaboratorySafety , EmergencyResponse ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

META GROUP MEETINGS – NYSBC We would like to provide each participating group the opportunity to conduct a 'group meeting' at NYSBC in whatever format the group finds ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise New in 2006 Round Table discussions of technical topics and application ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq 2008 ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Microtome Conversion Remove Cryosectioning unit Bake ...

Contents Making Movies from Image Stills under Linux Required Software 1 ImageMagick for easy format conversion, cropping, etc. 1 mjpegtools for encoding ...

Contents NYSB DG Program Committee Members Eliezer, Wu, Stokes, Hendrickson, Stark, Zhou, Cowburn Sublevel topic subsub level topic Set ALLOWTOPICVIEW ...

Outline of points from RFA Aims Quantitative characterization of machinery inside living cells that underlies cell function and regulation Engineer molecular ...

For quick comment Set ALLOWTOPICVIEW DavidCowburn, DirectorGroup, NysbcadminGroup

NIH Electronic Grant Submissions oppPA 07 070 cidVERSION 2A FORMS.xfd: unsolited R01 application file for !PureEdge oppPA 07 070 cidVERSION 2A FORMS instructions ...

Contents NEW YORK STRUCTURAL BIOLOGY CENTER LOCATION AND ACCESS Note that NYSBC has its principal operations at 133rd St and Convent Avenue in Manhattan, described ...

Various NYSBC Procedures New Affiliate Endorsement Procedures for setting up Teleconference and remote PC viewing Procedures for using Preapproved PO's ...

http://cowburnlab.org/nysbdg/NYSB DG11.jpg You can edit this page's source yourself if you have a NYSBC net login. Click http://www.nysbc.net/twiki/bin/edit/Main ...

  Summer 2013 Meeting 9:00 5:30 pm, Monday, 5th Aug, 2013, at Mount Sinai School of Medicine, Annenburg Stern Auditorium, 1468 Madison Avenue (at E. 101st Street ...

WInter 12 Anthony Armstrong (Lima Lab), MSKCC, Parsing recognition of a SUMO modified substrate: Recruitment of the anti recombinogenic helicase Srs2 by SUMO ...

New York Structural Biology Discussion Group Logistical Arrangements for Hunter School of Health Sciences vendor contacts: Kessler A J liquors 212 685 7651 at 28th ...

New York Structural Biology Discussion Group Winter Meeting Jan 2006 NysbdgVenueWinter2006 NysbdgSpeakersWinter2006 program2.pdf: program Nysbdg poster ...

NYU Structural Biology Program Requirements Required Courses Foundations Course I and II (1st and 2nd semester) Principles in Structural Biology (1st semester ...

NYU email lists (moderated only accepted from inside NYUSOM, use david.stokes@med.nyu.edu and smtp.med.nyu.edu) see https://listservprivate.med.nyu.edu/scripts ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Fiducial Markers for Tomography Jump to Principles Gold ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Negative Staining Jump to Principles You will need: ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Positive Staining Jump to Principles You will need: ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Solid Carbon Film Jump to Principles Using Mica (Best ...

Contents Past EM Journal Clubs and seminar speakers 31 Oct 2011 4 pm Richard Henderson : MRC Laboratory of Molecular Biology, Cambridge, UK, "What is needed ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Using the PDS 1010GM Microdensitometer Download MSWord file ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Plastic Coated Grids Jump to Principles You will need ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Plunge freezing Jump to Principles You will need: ...

Contents 8 10 psi Pressure Regulator for 22 psi Tanks Mc Master Carr Part Numbers 50695K165 qty 1 adaptor 50695K222 qty 2 37 degree fitting ...

To create a new Proposal Click on the gray box: "Create New Proposal" a file is created with an automatically generated name (of the form NewProposal ...

Contents Protein NMR Course NEXT OFFERED Jan 2009 CURRENTLY IN PROGRESS NmrCourse Compact summary of course, see below for full notes Course materials ...

Materials associated with PSI Meetings PSI Annual Meeting 2011 PSI mtg notes.txt: notes from PSI annual meeting Dec. 2011 PSI Biology Annual Meeting 2010 ...

Contents Robot disassembled due to planned move of 1230 (April 2016) Bill Rice Carl Nicolas Coudray David Stokes in consultation with John ...

CatalaseCrystals My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

Contents Group Page for the NYSBC Scientific Committee Specific areas (restricted to members) CEM section of scientific committee NMR section of ...

Mid 2009 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...

Contents Seminars / Education / Group listing Seminars There is no general seminar series. There are occassional special lectures. There is an ongoing informal ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM SerialEM Use Serial EM provided by David Mastronarde and colleagues from Univ. of Colorado, ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM Contents Notes on Serial EM Use and Configuration on Tecnai F20 Steps to recording a Low Dose ...

How to tunnel port through SSH (e.g. for using VNC remotely) Why? If you are at another institution or at home and wish to use/monitor NYSBC computer like the cluster ...

2009 Kissena Board of Directors PRESIDENT Stacey Jensen VICE PRESIDENT David Stokes TREASURER Eric Ragot SECRETARY Wai Fong SPONSORSHIP ...

This is an updated list of nominations for Kissena Board positions. This update includes new statements from several of the candidates (Eric M., Rufus, Joe, Wai ...

Final Nominations for the 2010 Kissena Board of Directors. Elections will be held by paper ballot at the club party on Dec 6th, 2009 at 7 PM. The location will be ...

PROTOCOLS from Stokes Lab Members Cell Culture yeast growth protocol vink.doc: Yeast Culture (Martin Vink) 12/2007 Yeast cultures.doc: Yeast culture protocol ...

List of NYSBC Intranet users Please take the time and add yourself to the list. To do that fill out the form in Registration. This will create an account for you ...

Visit the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tecnai F20 (basic operations) TEM data computer controls Fast Scan CCD holds data and provides ...

TEMIMPS Annual Meeting, April 19, 2011 TEMIMPS annual meeting agenda.doc: Agenda TEMIMPS annual meeting materials.pdf: Meeting Materials TEMIMPS Guests ...

TEMIMPS annual meeting materials.doc: meeting materials workshop agenda 4 10 2012.doc: Pre meeting workshop TemimpsMeetingSchedule2012 Attending Title ...

3rd TEMIMPS Annual Meeting Boston April 30 May 1, 2013 TEMIMPS annual meeting directions.pdf: TEMIMPS annual meeting directions.pdf TEMIMPS Third annual ...

Example entry 02 Feb 2011 MCMJR1 27 Jan 2011 MCV (Jan 27 Feb 10), cancelled due to cloning 25 Jan 2011 SFV (Jan 25 31), reschedule to Feb ...

Transcontinential Initiative for Membrane Protein Structure Meetings Temimps Monthly Meetings TemimpsAnnualMeeting2013 TemimpsAnnualMeeting2012 ...

Current Job Openings at NYSBC Entry level Technician Position in the Cryo Electron Microscopy Facility at the New York Structural Biology Center The Electron Microscopy ...

Contents TEMIMPS members Iban Ubarretxena , Andreas Engel , Pawel Penczek , Tamir Gonen , James Love , David Stokes cc: Changki Kim , Guozhi.Tao@uth.tmc.edu, goragot ...

Schedule for the TEMIMPS Annual Meeting April 10 11, 2012 Tuesday April 10 10:00 David: detergent calculator 10:30 Nicolas: 2dx parameter matrix ...

Contents blank minutes page.doc: template for minutes TEMIMPS PImtg Oct 10 2012.txt TEMIMPS PImtg Sep 4 2012.txt PI Meeting in Washington DC 7/2012 TEMIMPS ...

Annual Report 5/1/2012 Quarterly Report 4/1/2012 Quarterly Report 1/1/2012 Quarterly Report 10/1/2011 Quarterly Report 7/1/2011 Annual Report: May 1, 2011 Quarterly ...

Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...

TEMIMPS Workshop in Electron Crystallography Lecture Materials August 15 19, 2011 University of Washington School of Medicine, Seattle, Washington Lectures Lecture ...

xtracedrop program for characterizing drop shape and quantifying detergent concentrations Contents Program Installation xtracedrop is a python program (xtracedrop ...

Workshop in Dual Beam Scanning Electron Microscopy at the New York Structural Biology Center This workshop will introduce the new Helios 650 Nanolab microscope at ...

Visit the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tomography using TVIPS EM Menu 3.0 Contents This Software Is No Longer In Use at NYSBC : Use SerialEM ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM Tietz Tomography through EM Menu FEI Tomography software SerialEM tomography software Dual ...

Primer for use of TWiki for scheduling etc Make/Change an entry to any TWiki page TWiki pages can be edited by all registered users Click on "Edit" button ...

2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...

NYSBC Robot for automated sample insertion (John Henry) Robot/Leginon Startup Guide Robot/Leginon Technical Guide Robot General Guide Robot/Leginon ...

Calibration and Parameter setting of 2DX Robot Vacuum set points vacuum set points for insertion and extraction are contained in the file ~/robot software/robot ...

Robot Design Manuscript Set ALLOWTOPICVIEW DavidStokes 26 Sep 2009 Fig1.ai: fig 1 Fig2.ai: fig 2 Fig3.ai: fig 3 figure 4.ai: fig 4 Fig 5 ...

(15.4; 688.1; 0.1) Robot Manuals (leave this at the top) Controller manual RCX142 e.pdf: rcx142 manual (this is most useful) RCX143 144 e 0322 v1.02.pdf ...

Screening Results Manuscript Set ALLOWTOPICVIEW DavidStokes 26 Sep 2009 figure1.ai: fig 1 figure 2.ai: fig 2 fig 3.ai: fig 3 fig 4.ai: fig ...

Contents Listing of twiki pages to be automatically copied to nysbc web pages Instructions List any pages here that you want to be mirrored on our public site ...

Contents TwodxYiip TwodxYjbB TwodxZitB TwodxCryoLogBook CryoBor1p CryoCysZfragi Set ALLOWTOPICVIEW Set ALLOWTOPICVIEW ...

2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Edwards 306 Vacuum Evaporator Jump to Principles Carbon ...

This is a subscription service to be automatically notified by e mail when topics change in this Main web. This is a convenient service, so you do not have to come ...

Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...

Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...

Statistics for Main Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads ...

Contents Yeast Bench Processed High Pressure Frozen/Freeze Substitution New Piston Seal 9051nm50 007.jpg: Worn out piston seal ...

Screening and Scanning EM Film Procedure with screen shots available on web site http://www.nysbc.org/facilities/CEM/Zeiss PhotoScan Usage.html Download MSWord ...