2dx EmrE 2D crystallization trials Experiment of Mai 2011 (X71) Protocol About the protein: see the Protein acquisition form. conditions to screen: Dialysis ...

2dx EmrE (Shewanella Oneidensis) 2D crystallization trials Properties Amino acid sequence: M S W L L L I L A G L F E I G W A I G L K Y T D G F T R L W P S V ...

2dx Overview Contents Protocols Computing... crash total computer: ssh from another machine sudo init 3 sudo kill 9 whatever Xorg sudo init ...

2dx SFV 2D crystallization Contents Overview Experiments (date of protein delivery) July 1st 2009 Screen reference: X31 Conditions of best results (diffracting ...

AFFILIATION ENDORSEMENT AT NYSBC Your notes Please change this text to indicate any additional information not reflected on the form below ...

Name: Alex Shekhtman Email: ashekhta@albany.edu Company Name: SUNY A Company URL: Location: SUNYAlbany Country: USA Comment: PI ...

List AllHoursList OPERATIONS OUTSIDE NORMAL WORKING HOURS All hours access. 1.Purpose and General Comments 1 Purpose. The resources of NYSBC need to be ...

Contents Making Movies in Amira Instructions for version 3.0 (and above?) from David Stokes (created by Wanzhong He) 1 "install" the following scripts ...

Name: Andrea Nans Email: andrea.nans@gmail.com Company Name: New York University Company URL: http://saturn.med.nyu.edu/research/sb/stokeslab/ ...

Name: Andrew Pomfret Email%: Company Name: NYU School of Medicine Company URL: http://saturn.med.nyu.edu/~stokes/ Location: NYUSoMOffice ...

Contents Clemens Anklin Worshop 7/26/10 presentations topspin3.0.pdf: Topspin 3.0 NUS nysbc.ppt: Non Linear sampling in Topspin 3.0 1.7mmCRP nysbc ...

Name: Ann McDermott Email: aem5@columbia.edu Company Name: Columbia University Company URL: http://www.cise.columbia.edu/nsec/team/mcdermott.html ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Name: Arthur Palmer Email: agp@nysbc.org Company Name: Columbia Univ. Medical Center Company URL: http://www.palmer.hs.columbia.edu Location: ColumbiaMedCenterOffice ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW KaushikDutta 22 Sep 2005 nvjdata.tar:

Contents NYSBC Beamline Pictures Set ALLOWTOPICVIEW JasperShahn 18 Apr 2005

Name: Bill Rice Email: rice@nysbc.org Company Name: Company URL: http://www. Location: ParkBuildingOffice Country: USA Comment: CEM ...

Name: Binoj Jose Email: bjose@tspllc.com Company Name: TSP Company URL: Location: ParkBuildingOffice Country: USA Comment: Consultant ...

Detergent Removal with Biobeads Experiments Contents Topic Subtopic DMPC C12E8 room temp (April 25, 2011) DMPC (1 mg vacuum dried film) was mixed with C12E8 ...

Contents Broken Tip from Wohlwend HPF tip1.tif: tip1.tif tip2.tif: tip2.tif tip3.tif: tip3.tif tip4.tif: tip4.tif tip5.tif: tip5.tif ...

Burz, D.S., Dutta, K., Cowburn, D., Shekhtman, A. (2006) Mapping structural interactions in proteins using NMR (STINT NMR). Nature Methods 3 , 93 95 a Burz, D.S ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Principles Carbon Coating Jump to Protocol The best method to use ...

Name: Carmen Mannella Email: carmen@wadsworth.org Company Name: Wadsworth Company URL: http://www.wadsworth.org Location: WadsworthOffice ...

Catalase Crystals Recrystallization Protocol You will need Catalase from Bovine liver Vendor: Sigma CAS Number: 9001 05 2 Dialysis buttons or slides ...

Contents CCPN WORKSHOP AT NYSBC, 8 Sep 2008 , A 11 REGISTRATION STEPS 1 If you want to use the software, you need to register with CCPN http://www.ccpn.ac ...

Contents Bench Processed Bench Processed: desm112503 02.jpg: Plunge Frozen in Ethane desmo03.jpg: desmo04.jpg: High Pressure Frozen NYSBC ...

Contents 2013 CEM webpage refresh Background Refresh of CEM webpage to accommodate NYSBC new template. Architecture Public CemTwikiToWebList CemTwikiToWebMainPageTest ...

Image processing ZeissDensitometer Z/I Imaging (Zeiss) Photoscan Scanner Data processing computer cluster Users have access to a number ...

Contents NEW DUAL BEAM FIB/SEM MICROSCOPE AVAILABLE FOR YOUR USE The New York Structural Biology Center (NYSBC), to which your institution belongs, has recently acquired ...

Contents Processing FIB SEM data Make a stack of images 1 Copy data over from microscope 1 Select useful images 1 Make an mrc stack from several tif images ...

Contents Annual CEM BBQ 22 August 2014 CEM User meeting and Annual BBQ cembbq2014.pdf: 2014 flier Event: CEM user meeting Location: NYSBC, Room A 11 Time ...

Contents Making a bootable USB thumbdrive from a bootable Windows CD Background Tietz PC on J2100 has non functional CDROM drive Need to back up this PC ...

Contents The CLEM workflow is still under development. Sample workflow     Cartoon workflow Procedure     Instruments Nikon Light Microscope FEI Helios ...

Contents Ed's Overview of EM (cartoon version) Choice of an appropriate structural biological technique Before beginning a project one must match the biological ...

Contents General guidelines home directory has 20 GB space allocated to all of CEM computing /usr/data has 100 GB of space allocated to all of CEM computing ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 10th year at NYSBC Fall ...

Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered at NYSBC Fall 2005 Description: A comprehensive course in the theory and practice of ...

Download the flier CemCourseAnnounce.pdf: Cryo EM Course flier Set ALLOWTOPICVIEW DavidStokes 01 Aug 2006

Visit the !CryoEM web site at http://www.nysbc.org/facilities/CEM Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 4th year at ...

Visit the !CryoEM web site at http://cryoem.nysbc.org Cryoelectron Microscopy of Macromolecular Assemblies Graduate Course offered for the 8th year at NYSBC Fall ...

CEM Course Group Web Site for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" CemCourseAnnouncement CemCourseAnnouncement14 CemCourseSyllabus14 ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" Dec 6 ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Graduate Course "CryoElectron Microscopy of Macromolecular Complexes" Dec. 5 ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM Course Materials for Cryoelectron Microscopy of Macromolecular Assemblies COURSE EVALUATION CEM ...

Contents Dec 9 Visualization, Interpretation and Docking (Hernando Sosa) Lecture Presentation lecture dec9.mp3: audio of Dec 9 lecture Dec 2 Digital ...

Contents Class Evaluation form CEM Course evaluation 2009.doc: Course Evaluation Dec 8 Fitting Hernando Sosa Lecture Presentation Fitting EM12 ...

Contents Dec 7 Molecular Fitting Lecture Presentation sosa2.mp3: audio of lecture on molecular fitting Nov 23 Helical Reconstruction Lecture ...

Contents Dec. 7 Molecular Fitting Willy Wriggers Lecture NYSBC11.ppt: Molecular Fitting PPT Molecular fitting 20111206 2105 1.arf: recording ...

Contents Dec 4 Molecular Fitting Willy Wriggers NYSBC12.ppt: Molecular fitting lecture Wriggers 2012 Molecular Fitting 20121204 2102 1.arf: Molecular ...

Contents Dec 10 Molecular Fitting Wily Wriggers Lecture nysbc13.ppt: powerpoint of molecular fitting lecture wriggers.mp3: audio of molecular ...

Contents Player required for arf video files nbr2player.msi: MS windows player for arf files Lectures Structure Validation and Fitting Dec. 9 Lecture ...

Cryoelectron Microscopy of Macromolecular Assemblies 2005 NYU course G16.2617001 Call #30137 3 credits Contents Instructors David Stokes: stokes@saturn ...

Cryoelectron Microscopy of Macromolecular Assemblies 2006 NYU course # G16.4408 3 credits Contents Instructors David Stokes: stokes@saturn.med.nyu.edu ...

Cryoelectron Microscopy of Macromolecular Assemblies 2010 NYU course # G16.4408 4 credits credit also available at other institutions Instructors DavidStokes ...

Contents Instructors DavidStokes: stokes@saturn.med.nyu.edu BillRice: rice@nysbc.org IbanUbarretxena: iu@sci.ccny.cuny.edu HernandoJoseSosa: hsosa ...

Principles Background of structural biology and TEM technique TEM X ray crystallography NMR resolution 2 150 Å 1 5 Å 1 5 Å ...

Electron Crystallography Projects Zinc Transport YiiP protein – structural basis for an alternating access model Micrograph of negatively stained YiiP ...

Electron Tomography Projects Influenza: indentifying structural characteristics in egg adapted vaccine preparations A 7Å thick section through a tomographic ...

Contents Name of the topic Sublevel topic subsub level topic https://filesender.internet2.edu/?vid 4fb117fb 09da 79e8 3afc 0000459e2125 Set ALLOWTOPICVIEW ...

Contents Fib/SEM CemFibSEMProcessing tif2mrc Image .tif rawstack.mrc xfalign matt 0.1 reduce 1 bilinear params 2 sobel rawstack.mrc rawstack.xf xftoxg n 0 rawstack ...

Contents Projects NYU Ned Seeman June 29, 2012 Initial meeting Steve Hubbard/Todd Miller February 23, 2012 First email from Steve March 9, 2012 ...

The NYSBC houses a state of the art electron microscopy facility in upper Manhattan. For an overview of the resources in our CEM facility follow the links below. ...

The NYSBC houses a state of the art electron microscopy facility in upper Manhattan. For an overview of the resources in our CEM facility follow the links below. ...

Microscopes The microscopes at the NYSBC are located in specially built rooms, each one including a concrete slab that is supported directly by the bedrock of the ...

Microscopes The microscopes at the NYSBC are located in specially built rooms, each one including a concrete slab that is supported directly by the bedrock of the ...

Contents Slice and View Images Images collected using slice and view are saved as a series of 8 bit tiffs Since contrast on SEM is inverted from usual TEM ...

How to install Flash Plugin in 64 bit Linux systems The problem is that the flash plugin is designed for 32 bit and will not run on the 64 bit machines. 1. Get ...

Previous Staff Members Scientist: Mariena Silvestry Ramos Technical Director: Ruben Diaz Avalos ...

Capabilities of NYSBC's CEM Lab Printable Brochure General Information The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate ...

Capabilities of NYSBC's CEM Lab General Information The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate the intermolecular interactions ...

Contents Fei Helios Instructions Sample prep Samples come in resin blocks Trim block size These generally need to be trimmed to ~1cm height so they will ...

Contents Projects on the Nanolab Characterization of organelles in identified cells in the nematode, C. elegans PI: Dave Hall Institution: Albert Einstein ...

Contents Homework Uploads To get the most out of this course, it is required to do all of the practical sessions Students taking the course for credit are ...

Beginning an electron microscopy project High Purity? Usually, a project aimed to determine structural information of a given material is ripe for study when a high ...

Beginning an electron microscopy project High Purity? Usually, a project aimed to determine structural information of a given material is ripe for study when a high ...

Capabilities of NYSBC's CEM Lab Printable Brochure Introduction The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate the intermolecular ...

TECHNOLOGY / INVENTION DISCLOSURE FORM If you used a pro microinjection technique to create a transgenic animal, please check this box. If your technology includes ...

Visit Cryo EM website at http://www.nysbc.org/facilities/CEM !CryoEM facility at NY Structural Biology Center CapabilitiesCEM.doc: MS Word version CapabilitiesCEM ...

Contents Networking nfs mounts made directories /cem02bigdata/, cem03bigdata/, /cem12data/, ... change group of each one from "staff" to "wheel" under ...

CryoEM Administration Cowburn's email list June 11,2004: cowburn science email.txt See also DGmailList NYU email lists (moderated) postdoc@lists ...

CEMFacGroup Page CEM Administration Page CemChillerWaterLevels CEM Equipment Maintenance Maintenance Checklist Monthly Task Subtask Location ...

Contents 20130807 ArgC Nanodisc staining. 1/10 dilution of stock in TBS. 20 sec air glow discharge of continuous carbon on copper grids. 4 uL incubated ...

Microscopes The microscopes at the NYSBC are located in specially built rooms, each one including a concrete slab that is supported directly by the bedrock of the ...

Contents General Questions Question: I have a protein and want to do EM, what do I do? If you have a protein or a protein complex that has a MW ~300kDa ...

Contents Nikon Ti U Description Users have access to a Nikon Ti U inverted fluorescence microscope with a FEI Cryo Stage2 system. It allows screening of electron ...

Capabilities of NYSBC's CEM Lab General Information The goal of the NYSBC cryoelectron microscopy facility is to help researchers elucidate the intermolecular interactions ...

Cryo Electron Microscopy Information and Instructions Visit the Cryo EM Web site at http://www.nysbc.org/facilities/CEM Contents wavelengths 80kV: 0.04176 ...

Plunge freezing With the advent of improved equipment from several different vendors, the preparation of unstained specimens for electron microscopy has become somewhat ...

Published work using the NYSBC Cryo EM Facility. Examples of work done at the NYSBC List of Publications Examples of work done at the NYSBC     ...

go to CemPublications

Contents Reconstruction by Random Conical Tilt Principals For a very good description, see Frank (2006) Three Dimensional Electron Microscopy of Macromolecular ...

Current NYSBC Research Projects Collaborations Electron crystallography Helical reconstruction Single particle analysis ...

Contents Robot Instructions These instructions are not meant to replace proper training Preparation Start usage log Switch toggle to robot . ...

Reading and setting robot coordinates in robot controllers Manual robot control and hand controller operation using iRobot to manually control robot movement ...

Contents Leginon/Robot Technical Guide Minghui robot tech guide.doc: Robot Technical Guide (MS Word format) Leginon Update As of Feb 2010, Leginon is under major ...

Contents User Guide for Robot/Leginon on JEOL 1230 Minghui Hu Friday, February 26, 2010 Minghui Leginon setup guide.doc: MS Word version PC access abc123 Checklists ...

Contents Camera Webpages http://192.168.5.160 http://192.168.5.166 Automated Control and Robotics on 1230 Options for Automated Control ...

Contents See general guidelines for metal shadowing here. Rotary shadowing using the Edwards Auto 306 Evaporator General setup Make sure gloves are worn at ...

Sample preparation In addition to the state of the art electron microscopes, the NYSBC is fully equipped to meet the sample preparation needs of the structural biology ...

Courses and Seminars related to !CryoEM At the NYSBC CEM User meeting and Annual BBQ Event: CEM user meeting Location: NYSBC, Room A 11 Time: Friday, August 22, ...

Contents Ongoing issues Tecnai New apertures installed March 6 2015 Objective: 100 um, 50 um, 50 um, 40 um condenser: 150 um, 100 um, 70 um, 50 um BUT third ...

Contents Notes on using the ingle particle helical suite of software Source http://emlab.rose2.brandeis.edu/helical publication: sample data: http ...

Staff of the Cryoelectron Microscopy Facility Scientific Co Director: Bridget Carragher emg@nysbc.org tel: (212) 939 0660 ext 97241 fax: (212) 939 0863 webpage ...

Temperature logs of EM suites attached Set ALLOWTOPICVIEW BillRice 09 Feb 2011 j3200 2011 dec2014.zip: jeol3200 temp logs to dec 20 2014 tf20 2011 ...

CEMUserhandbook ver1.pdf: CEM User Handbook version 1.00 EM User Handbook Note: Policies may have been updated since this handbook has been completed so please contact ...

Welcome to the CEM home page SAFETY at NYSBC CEM Newsletter EM Related Seminars and Courses New EMG sites Leginon / Appion EMG site New scheduler ...

Parking There is intense pressure on CCNY's parking lot at 133rd St. Now, this will continue with CCNY's own construction projects. NYSBC cannot offer parking ...

Program Challenges in Biology 1:00PM Wednesday Mar 18, 2009 Rockefeller University, Weiss Building, 17th floor A series of nomadic / peripatetic lectures in New ...

SAFETY Information for NYSBC EmergencyResponse All Hours info for NYSBC All Hours CEM Specific Info General Operating Handbook Chemical Safety ...

Contents Cluster Usage Instructions The Computing Cluster at NYSBC is now fully operational. Requests for processing time can be made to infotech@nysbc.org. Technical ...

NEW YORK STRUCTURAL BIOLOGY CENTER Confidential Conflicts of Interest Disclosure Form This form should be submitted annually and updated within 30 days ...

Columbia University

Contents Commerical news items NYSBC provides this for information only. NYSBC DOES NOT ENDORSE THESE RELEASES OR THE PRODUCTS IN ANY WAY. Company Announcement ...

Contents Linux 64 bit System Notes AMD and 64 bit Compilation Notes gcc under 64 bit linux is 64 bit Use the m32 switch in gcc if you want to compile in ...

Contents Audio solution for conference room What we want We would like to set up a course to be broadcast over the internet to users in Albany. In order to do this ...

Contents Photos of Phase 3 Construction (Updated Daily) For full scale picture, right click on small version and select "View Image" or click on link (eg 40105.JPG ...

Contents Vendor Contacts arranged by company name Name Position Company Phone email account number Markus ABRA Fluid/ work with ...

CryoEM course evaluations Thank you for attending the course and thank you for submitting an evaluation. It will help us improve the course for next year. We ...

Patents associated with David Cowburn Available 1. United States Patent 5,888,763 Hanafusa , et al. March 30, 1999 Peptides specific for the first Crk SH3 ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

9 May '10 8 Mar '10 Set ALLOWTOPICVIEW DavidCowburn 12 Mar 2010

Current Announcements Pages with additional details specifically for PIs NMR Users EM Users Beam line Users External events Meta Group ...

CUNY excavation. Change of schedules, All hours, late night, weekend, and holiday access. EM users should be aware of possible Impact until further notice. The detailed ...

Detergent Removal with Cyclodextrine Experiments Contents Overview, references... Experiments 2011, August 25th Tuesday's meeting comment CD Yiip in microdialysis ...

DSA for DC: Matlab program (Drop Shape Measurement for Detergent Concentration quantification) Contents Program Installation DSA for DC is a matlab program developed ...

Optical Bench and Scanner Instructions Darkroom Protocols Developing Film WEAR GLOVES!!! Protocol 1 Turn on red safe light by flipping switch down. 2 Fill ...

Name: David Cowburn Login Name: cowburn Email: david.cowburn@einsteinmed.edu Location: Einstein Address: DavidCowburnAddress Einstein Web ...

Name: David Eliezer Email: dae2005@med.cornell.edu Company Name: WMCCU Company URL: http://www.med.cornell.edu/research/deliezer/ Location: WMCCU ...

My User Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences ...

Name: David Stokes Email: stokes@nyu.edu Company Name: NYU Company URL: http://stokeslab.med.nyu.edu Location: Skirball Institute 3 13 Country ...

Directions to the Davis Auditorium, Columbia University View Larger Map

Contents Alumni and Current Associates Gaya Amarasinghe , Washington U., St. Louis Joseph Ashcroft , Pfizer Bhattacharya, NYSBC Sean Cahill, ...

Desmosome Paper Set ALLOWTOPICVIEW GethinOwen 01 May 2006 Cad org of bovine des.doc: Very rough draft of the characterisation of methodology for isolated ...

Experiments Detergent Concentration Calibration curves using the drop shape measurement method Contents Theoretical values From Anatrace: Detergent Abbreviation ...

Surface tension measurement to determine detergent concentration in a solution; tool description Background The propensity of detergents to alter the surface properties ...

Detergent and lipid screens Contents MCMJR1 MCMJR1 FC 12 Lipid Stability Screen Superdex200 5 150 MCMJR1 Lipid Screen2.ppt: MCMJR1 FC 12 Lipid Stability Screen ...

Name: Devrim Acehan Email: acehan@saturn.med.nyu.edu Company Name: NYU Skirball Institute Company URL: Location: NYUSoMOffice Country: USA ...

Contents NYSBC DNP SYMPOSIUM Friday Nov. 12 2010 Room A 11 Participants Name Confirmed Talk Title Ann McDermott Bob Griffin Will send Bjorn ...

Contents Most recent version of the EMG Training Manual Set ALLOWTOPICVIEW AshleighRaczkowski 14 Apr 2015 EMGTraining v02 15 04 06.pdf: EMG Training ...

http://www.nysbc.net/twiki/bin/viewfile/Main/EinsteinGrants?rev 1;filename Capture.JPG SC subcontract F Future Faculty

Contents C. Elegans Pharynx New Piston Seal Gut1.jpg: Gut2.jpg: After Piston Assembly Replacement Pharynx.jpg: Set ALLOWTOPICVIEW ...

Name: Elena Yakubovskaya Email: elena@pharm.stonybrook.edu Company Name: SUNY Stony Brook Company URL: http://www.pharm.stonybrook.edu/Faculty/Professors ...

EM Imaging Processing GUI EMIP EMIP is a Graphical User Interface written in wxPython that collects information from the user and runs existing programs from ...

Contents Installation and Updating of EMAN2 Download and untar the latest release from http://blake.bcm.edu/emanwiki/EMAN2/Install/BinaryInstall go to installation ...

Contents Round Table Discussion of protein dynamics and catalysis studied by NMR and crystallography, with the recent Kern/ Alber Nature paper as starting point. ...

Name: Ertan Eryilmaz Email: Ertan.Eryilmaz@einstein.yu.edu Company Name: Company URL: Location: EinsteinOffice Country: Comment ...

MATERIALS REAGENTS Ampicillin or carbenicillin Plasmid pRSF.1b (Novagen), containing the cDNA for the protein M9 medium (see REAGENT SETUP) ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Principles Freeze Substitution Jump to Protocol Important considerations ...

Contents Processing of Tomograms using the FSU package fiducial free system new scripts automate much hand editing of files list of scripts setup ...

Contents Automated Control and Robotics on 1230 Options for Automated Control SerialEM already installed, but does not fully work because of emulator ...

NEW YORK STRUCTURAL BIOLOGY CENTER POLICIES Printable version of this file. (pdf format) COMPUTER ELECTRONIC COMMUNICATIONS POLICY The Center’s policy on the ...

GENERAL REFERENCE ITEMS FOR AFFILIATES AND STAFF AT NYSBC Frequently requested Intranet Pages Beamline facility page CEM facility page, ...

GethinOwen 11 May 2006 Freeze sub solution method He.sxw: freeze substituion cryo low dose em.sxw: low dose em step by step holey carbon grids.sxw: Triafoil ...

Name: Gethin Owen Email%: Company Name: NYSBC Company URL: http://www. Location: ParkBuildingOffice Country: USA Comment: CEM lab was ...

Glow Discharge in Edwards 306 Recommended that Glow Discharge be carried out by the dedicated units You will need to install the plasma ring for this procedure ...

Contents Glow Discharge Unit Mechanical Drawings glowdischarge.pdf: glowdischarge.pdf Images glowdischarge.jpg: glowdischargeview2.jpg: glowdischargeview3 ...

Contents Oscilloscope Data 0,45 aperture shot 3078.pdf: shot 3078.pdf shot 3079.pdf: shot 3079.pdf shot 3080.pdf: shot 3080.pdf Set ALLOWTOPICVIEW ...

Tuesday Group Meeting Reports 03/05/2013 UMA, MCMJR1 (Iban) 5 mutations done bt Bryan (as in the published paper). Expression ok. Will be scaled up at MSSM ...

Name: Guobin Hu Email: ghu@saturn.med.nyu.edu Company Name: NYUSOM Company URL: http://www. Location: NYUSoMOffice Country: USA Comment ...

Application for Dual Beam SEM for HEI program S10 SEM nih compiled grant.pdf: NYU S 10 SEM grant Set ALLOWTOPICVIEW DavidStokes 04 Apr 2009

Contents Helical Processing : Initial steps display tube image and transform mrcdisp to display hft to calculate fft (must create id.box file with box ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Helical Reconstruction using EMIP This protocol uses software that originated ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols High Pressure Freezing Jump to Principles Equipment Instructions ...

Grey Clare P. Grey, Stony Brook University is awarded the Ampere Prize for her work " Energy Storage and Conversion: Using Local Structural Probes to Understand ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Using the Bal Tec High Pressure Freezer Jump to Principles ...

Name: Iban Ubarretxena Email: Iban.Ubarretxena@mssm.edu Company Name: MSSM Company URL: http:// Location: MSSM Country: USA Iban Ubarretxena ...

Contents Ice Contamination Rate Test Theory All intensity measurements are proportional to number of electrons passing through sample. Measure them either directly ...

Contents Prerequisites 1 python 1 gtk and glib. If the FSU software has been installed already then the required libraries should already be present 1 wxGTK ...

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

Name: Jasper Shahn Email%: Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Phone: 1 212 939 0660 x 9102 ...

JEOL 1230 The JEOL 1230 is mainly used as a screening microscope. It has a tungsten filament and a side entry Erlangshen Gatan camera mounted at the 35mm port. The ...

Contents JEOL 1230 Instructions Log in User Name: su Password: 1230 Specimen Insertion Flip toggle switch to "pump" (G) Line up pin on holder ...

Room 118 LogBook; experiments, debugging and updating... Manual use of 1230 1. Check the robot is not running (Leginon would appear and run on the main screen ...

JEOL 2100 The JEOL 2100F operates with an accelerating voltage of 200kV. It is equipped with a Schottky field emission gun and an array of three condenser lenses, ...

Contents JEOL 2100 Microscope Parameters wavelengths 200kV: 0.02508 A objective lenses f 2.8 mm Cs 2.0 mm Chromatic aberration 2.1 mm ...

JEOL 2100 Instructions Visit the Cryo EM Web site at http://www.nysbc.org/facilities/CEM K2 Camera Regular Maintenance Anneal cycle should be run weekly ...

JEOL 3200FSC The JEOL 3200FSC is a state of the art instrument that operates with an accelerating voltage of 300kV. It is equipped with a Schottky field emission gun ...

JEOL 3200 Microscope Parameters wavelengths 300kV: 0.01969 A objective lenses f 4.4 mm Cs 4.1 mm Chromatic aberration 3.4 mm Aperture ...

Contents JEOL 3200 training 3200 training notes.doc: DLS notes on 3200 training Cryogen fill Chuck dewar Fill in morning and last thing at night ...

Name: JoelSandler Email%%: jsandler at mail.rockefeller.edu Company Name: Company URL: http://www. Location: RockefellerUOffice Country: USA ...

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

Name: John Schwanof Email: schwanof@bnl.gov Company Name: Company URL: Location: BNLOffice Country: USA Comment: Personal Preferences ...

Name: Jorge Jose Email %% : Company Name: Buffalo Company URL: http://www. Location: SUNYBuffaloOffice Country: USA Comment: Filled ...

Name: Kaushik Dutta Login Name: kdutta Email: dutta@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice ...

Name: KD Derr Email: kderr@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Serial EM Support Resources ...

Contents Laboratory Safety and Environment Issues at NYSBC There is a general safety manual. Human/ animal samples ALL human or animal samples must be derived ...

Laboratory Safety and Environment Committee Pages See LabSafetyEnv for the public documents nysbc laboratory safety links LaboratorySafety , EmergencyResponse ...

Contents Nota: next updates of Leginon should be done on jeol1230 and on cem12. April Mai 2011 Modification of pyscope/jeol1230.py see jeol1230.py Autofocus ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW KaushikDutta 17 Feb 2010

Protein solubilization experiments Summary C12E8 DDMDMFC12C10E9OG Brain Polar 3 ...

My Links .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting points on TWiki .TWikiUsersGuide ...

Contents MALS MALS MALS Set ALLOWTOPICVIEW RalphLasala 14 Jan 2013 01 General MALS Theory 2012.pptx: General MALS Theory 02 Flow Cell Cleaning ...

Contents Common Troubleshooting Vacuum Evaporator Notes Jay Pariseau BOC Edwards 13 APR 05 Wear gloves when touching sources Positive source ceramic Negative ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

My Project Logbook My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners ...

Automation of jeol1230 with iRobot, Leginon and Animated TEM Contents Startup User manual to use Leginon combined with the Matlab nodes associated to the Animated ...

Contents The following are the System Requirements for Maya unlimited – 32 Bit Version Microsoft Vista or XP Apple OS X 10.5.2 or ...

Contents Configuration of the Memory Hole on 64 bit AMD Systems The Problem From the official Tyan FAQ: Why does my OS see less than the total memory installed ...

META GROUP MEETINGS – NYSBC Held in A 11 Park Building at 1:30 pm unless noted otherwise MEETINGS IN NEXT SIX WEEKS Other questions? See MetaGroupFaq 2015 ...

Contents Names of the Member Institutions of NYSBC note that file service for these images will be from nysbc.org/images/logos Name Local abbreviations ...

Name: Michael Goger Email: gogerm@nysbc.org Company Name: NYSBC Company URL: http://www.nysbc.org Location: ParkBuildingOffice Country ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Tests of the micro dialysis plates performances Reference See MicroDialysisPlatesTool for an overview and information about the protocol. Experiments; test of the ...

Micro dialysis plates Overview (Martin's archive July 2010) Design An advantage of 2D crystallization relative to 3D crystallization is the use of relatively low ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW RonnieGhose 04 Apr 2009

Name: Ming Ming Zhou Email: ming ming.zhou@mssm.edu Company Name: MSSM Company URL: http://www.mssm.edu Location: MSSM Phone 212 659 8652 ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

NEW SERIES IN "Challenges in Biology". In collaboration with the Institutions, NYSBC is sponsoring a series of Mini Symposia with distinguished lecturers. This ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

See MOD1 MoD2 MoD3 MoD4 MoD5 MoD6 MoD6X MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 MoD17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 MoD26 MoD27 ...

Lecture 10 content see MoD9 3dmanual.pdf: 3dmanual.pdf for lecture 10 11 The through bond assignment strategy and triple res experiments how they work ...

Module 12. Analyzing spectra for assignment etc. General review of approach. Use of NMRVIEW

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW MichaelGoger 06 Oct 2011

Review and Midterm take home exam

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW MichaelGoger 20 Sep 2011

classBBassign II.ppt: classBBassign II.ppt

Mid term test see midterm.pdf Module 13. Advanced preparation issues Pichia, cell free, segmental labeling, strategy selection proteinprep2.ppt: proteinprep2 ...

Module 19 Illustrative example of calculation flow using Aria protocol Suggested Reading /Guntert03.pdf ; /RiepingHabeck07.pdf ; /LingeODonoghue01.pdf

See MoD1 MoD2 MoD3 MoD4 MoD5 MoD6 MoD6X MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 MoD17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 MoD26 MoD27 ...

Module 20 Examination of the refinement process and incremental additional assignment strategies for structure generation classStrCalII.pdf: classStrCalII.pdf ...

Lecture on assessment of structures in a larger context /NabuursSpronk06.pdf /BhattacharyaTejero07.pdf /AbAtkinson06.pdf

Module 23 Strategies for larger proteins , RDCs and other methods for molecular machines References /Blackledge05.pdf Module23.pdf: Lecture notes for module ...

Module 24 Student presentations (1) ProteinNMRCoursePapers.zip: ProteinNMRCoursePapers.zip ProteinNMRCoursePapers.zip: ProteinNMRCoursePapers.zip

Ligand Design with NMR NYSBC 052007.pdf: Ligand design with NMR, MMZ

Class Rapid Acquisition Methods.pdf: Rapid ACquisition Methods in NMR

Lecture 3 See MoD2 MoD3 MoD4 MoD5 MoD6 MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 Mod17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 Mod26 MoD27 ...

presentation 052207.pdf: Palmer lecture 2

Lecture 4 See MoD2 MoD3 MoD4 MoD5 MoD6 MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 MoD17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 Mod26 MoD27 ...

Lecture 5 See MoD2 MoD3 MoD4 MoD5 MoD6 MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 Mod17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 Mod26 MoD27 ...

Lecture 6 See MoD2 MoD3 MoD4 MoD5 MoD6 MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 Mod17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 Mod26 MoD27 ...

Module 6 X.pdf: Module 6 X.pdf References 1 /PackerWright83.pdf 2 /SorensenEich84.pdf

Lecture 7 See MoD2 MoD3 MoD4 MoD5 MoD6 MoD7 MoD8 MoD9 MoD10 MoD11 MoD12 MoD13 MoD12 MoD15 MoD16 Mod17 MoD18 MoD19 MoD20 MoD21 MoD22 MoD23 MoD24 MoD25 Mod26 MoD27 ...

Module 8.pdf: Module 8.pdf

Module 9.pdf: Module 9.pdf for lecture 9, Side chain Assignments

Contents CoursePack.pdf: All Course Materials: Single File

Contents Making Movies from Image Stills under Linux Required Software 1 ImageMagick for easy format conversion, cropping, etc. 1 mjpegtools for encoding ...

Mukherjee, M., Dutta, K., White, M.A., Cowburn, D., Fox, R.O. (2006) "NMR solution structure and backbone dynamics of domain III of the E protein of tick borne ...

Contents 22 January 2014 NYSBC webpage Joe revision mockup 01 NYSBC Website Index.jpg: 02 NYSBC Website Page.jpg: 15 January 2014 NYSBC webpage ...

Name: Natacha Opalka Email: opalkan@rockefeller.edu Company Name: Company URL: http://www.rockefeller.edu Location: RockefellerUOffice Country ...

Contents New User Setup Tecnai F20 Create new accounts on both computers and Greymatter Set passwords to never expire Windows 2000 or XP ...

EM Newsletter Archive Current edition: Spring 2014 2014 Spring 2014 2013 Winter 2013 Fall 2013 2012 Fall Winter 2012 Summer 2012 ...

NIH Electronic Grant Submissions oppPA 07 070 cidVERSION 2A FORMS.xfd: unsolited R01 application file for !PureEdge oppPA 07 070 cidVERSION 2A FORMS instructions ...

Contents How to deal with uneven grid? 1) take a Z ­ #8208;stack between a defined Z range 2) auto focus each image or every so often 3) use a focus surface 4 ...

Contents Nikon Ti U Inverted Light Microscope (basic instructions) Note: If there is a user after you, leave the Hg lamp on. Every time you turn on the Hg bulb ...

Contents COURSE ANNOUNCEMENT Title: Biochemistry GR6270 NMR Spectroscopy of Macromolecules Instructors: Arthur G. Palmer Department of Biochemistry and Molecular ...

NMR related courses at NYSBC and recommended elsewhere Protein NMR Course , Formal identity CUNY Course CHEM 86900 Special Topics: Biomolecular NMR Spectroscopy ...

Contents Internal features Fitting a single Kd to multiple shift titration data NmrTitration 1 Demo script LIBRARY:matlab/lib1/titrationscript.html or NmrTitration ...

Contents Operation of the NYSBC NMR Instruments. Important new information on temperature calibration June 2007 Nmr Password Synchronization Quick ...

Contents Notes For 900#1 Pulse Calibrations For pulse calibrations click on the following link: shapepulse 9001 44910 0005.xls: PowerMeasurements900 ...

Contents Photographs of NYSBC NMR Facility Sublevel topic NYSTAR Cal shot on line image print quality Panorama of A level magnet room, by Clemens ...

Contents Nmr Proteomics List NESG This is the html version of the file http://www.nesg.org/docs/NESG2.1.doc. Northeast Structural Genomics Consortium ...

Contents NMR schedule for NYSBC Authorized users can edit the underlying information at NmrSchedule Notes for Nmr Schedule Notes for Nmr Schedule FAQs for NMR ...

NMR SCHEDULE FOR NYSBC . This is the ALPHA release of the cycle 24 schedule. You are advised when using this for planning to always reload your ...

Released 24 Sep 1603 Cycle Date Week Instr. Mem. Inst. Comment 29 Tue Sep.30,2008 317 800/US#1NW/TCI Scipri ...

Contents NMR Short Course, TBD Solution NMR WHO ...

Contents NMR Solid State Short Course Solid State NMR WHO The short course for NMR is a training period for spectrometer ...

Current function in Matlab LIBRARY:matlab/lib1/titrateKD.m function out titrateKD ( shifts, nomcon, protein, other) % % shifts a vs . ns matrix of shifts ...

NYSBC operates solution state NMR spectrometers at 500, 600, 700, and 800 (x3) MHz and 900 (x2) MHz. A 750 WB and part of one 900 time are used for solids. See ...

Non linear Sampling Scientific objectives 1 Maintain resolution, sensitivity, and precision with less measurement time Technical objectives 1 Implement sequence ...

Contents NYCOMPS Targets NYCOMPS Target Lists will be attached to this topic. Sublevel topic subsub level topic Set ALLOWTOPICVIEW DhireshVyas 24 Mar ...

Contents NEW YORK STRUCTURAL BIOLOGY CENTER LOCATION AND ACCESS Note that NYSBC has its principal operations at 133rd St and Convent Avenue in Manhattan, described ...

Intra mural pages for NEW YORK STRUCTURAL BIOLOGY CENTER You will need to register as a NYSBC Intranet user at http://www.nysbc.net/twiki/register.html to get access ...

Contents Posters for use at meetings for NYSBC There probably should be specific ones for all areas, and general ones also..., but we start with NmrPoster and General ...

  Summer 2013 Meeting 9:00 5:30 pm, Monday, 5th Aug, 2013, at Mount Sinai School of Medicine, Annenburg Stern Auditorium, 1468 Madison Avenue (at E. 101st Street ...

Contents NYSB DG Summer 2011 Pictures Courtesy of Temel Speakers and Chairs, Summer 2011: (L R) Cowburn, Thomas Schalch, Yinghao Wu, Gavathiotis, Alexander ...

Summer Meeting 2013, Mount Sinai School of Medicine Helen Berman, Rutgers Univ. Structural Biology Data and Information Resources: New Features and Functionalities ...

New York Structural Biology Discussion Group Logistical Arrangements for Hunter School of Health Sciences vendor contacts: Kessler A J liquors 212 685 7651 at 28th ...

New York Structural Biology Discussion Group Winter Meeting Jan 2006 NysbdgVenueWinter2006 NysbdgSpeakersWinter2006 program2.pdf: program Nysbdg poster ...

Contents Summary of the 2013 Winter Meeting Program Confirmed Speakers Aneel Aggarwal, Mount Sinai School of Medicine "DNA Protein Recognition : Engineering ...

NYU Structural Biology Program Requirements Required Courses Foundations Course I and II (1st and 2nd semester) Principles in Structural Biology (1st semester ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Negative Staining Jump to Principles You will need: ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols TRIAFOL METHOD Jump to Principles Holey carbon grids ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Contents Past EM Journal Clubs and seminar speakers 31 Oct 2011 4 pm Richard Henderson : MRC Laboratory of Molecular Biology, Cambridge, UK, "What is needed ...

My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal Preferences Uncomment preferences ...

Name: Paul Gottlieb Email: pgottl@med.cuny.edu Company Name: CUNY Company URL: Location: CUNYCCNYOffice Country: USA Comment: PI My ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Using the PDS 1010GM Microdensitometer Download MSWord file ...

CEM Workshop 21 Sep 04 DavidCowburn 07 Sep 2004 JPG: JPG: JPG: JPG: JPG: JPG: JPG: ...

Flood issues, of 29 Sep MG Photos DavidCowburn 07 Sep 2004 JPG: JPG: JPG: JPG: JPG: JPG: ...

ex Physical Biochemistry Laboratory, New York Structural Biology Center No longer active. Cowburn Lab at Einstein Cowburn Full Biographical Sketch ...

Contents Moving Blog Library access including on line jounrals WITH ID CARD Faculty staff located on the Resnick campus must register in person at ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW DavidCowburn 07 Sep 2004 900picsMar2 05.msg: Multiple pics sent ...

ALLOW TOPICVIEW AndreaPiserchio, RonnieGhose, DavidCowburn,

Contents Plunge Freezer Mechanical Drawings plungefreezer.pdf: plungefreezer.pdf Images styrofoambox.jpg: styrofoamview2.jpg: styrofoamboxplatform ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Plunge freezing Jump to Principles You will need: ...

2Dcrystallization.doc: SERCA/PLB 2D Crystallization Protocol 2Dcrystallography.doc: 2D Electron Crystallography Processing Procedure TomographyProcessing ...

Contents Power Measurements for 600 Low Power Low power measurements: As of 12/8/05 The low power measurements were done with 1GHz oscilloscope via 1m RG241 cable ...

Contents Previous Support, David Cowburn Rational Design of Regulators of Programmed Cell Death in Human Breast Cancer 1 USAMRMC DAMD17 99 1 9363 2 "Rational ...

NYSBC PROCEDURES FOR OBTAINING C14 OPERATIONS OF A CHEMISTRY LABORATORY CERTIFICATE OF FITNESS All users will be specifically trained on the NYSBC premises with ...

Contents Protein NMR Course Fall 2018 Compact summary of course, see below for full notes Information about grades for the University admin folks ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW MichaelGoger 20 Sep 2011

Contents Protein NMR Course Spring 2015 Compact summary of course, see below for full notes Information about grades for the University admin folks ...

Materials associated with PSI Meetings PSI Annual Meeting 2011 PSI mtg notes.txt: notes from PSI annual meeting Dec. 2011 PSI Biology Annual Meeting 2010 ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW KaushikDutta 22 Sep 2005 rdcdata.tar.gz:

Record of Reconstruction for Ph II labs 11 Aug 09 After demolition 19 Aug 2009

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW KaushikDutta 22 Sep 2005 t1relax.tar.gz: t2relax.tar.gz: ...

Name: Robert Grassucci Email: rg2502@columbia.edu Company Name:Columbia University Dept of Biochemistry and Molecular Biophysics Company URL: http: ...

Contents Robot disassembled due to planned move of 1230 (April 2016) Bill Rice Carl Nicolas Coudray David Stokes in consultation with John ...

Name: Ronnie Ghose Email: rghose@sci.ccny.cuny.edu Company Name: CUNY CCNY Company URL: http://www.ccny.cuny.edu http://www.sci.ccny.cuny.edu/~ghose ...

Contents Comparison between Albany and NYSBC HPM 010 andreasample1.png: Figure 1: Conventionally, chemically fixed corpus callosum versus high pressure frozen ...

Name: Ruth Stark Email: stark@sci.ccny.cuny.edu Company Name: CUNY Company URL: Location:CUNYCCNYOffice Country: USA Comment: Dr. Ruth ...

My Project Proposal My Logbook My Links .NysbcIntro your introduction to NYSBC .NetLiterate short introduction to the style of this intranet Personal ...

Small Angle Scattering Primer SAXS BNL Presentation NYSBC presentation s.pdf: NYSBC presentation s.pdf PartOne final.pdf: NIH 2009 part 1 PartTwo ...

Contents Structure Calculation in NMR Notes for Round Table Discussion Jan 18 MetaGroup The purpose of this round table is to increase the understanding of the ...

Contents Group Page for the NYSBC Scientific Committee Specific areas (restricted to members) CEM section of scientific committee NMR section of ...

February 2008 Scientific Report, NYSBC See http://www.nysbc.net/twiki/bin/viewfile/Main/ScientificReport?rev 1;filename Feb08ScientificReport.pdf for final pdf ...

Contents June 2007 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...

June 2008 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...

Mar '10 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...

Mid 2009 Scientific Report, NYSBC Introduction In order to provide Principal Investigators and other interested parties a continuous overview of the scientific ...

Nov 2008 Scientific Report, NYSBC Figure contents described on last page. Introduction In order to provide Principal Investigators and ...

Return to the Cryo EM Website at http://www.nysbc.org/facilities/CEM SerialEM Use Serial EM provided by David Mastronarde and colleagues from Univ. of Colorado, ...

Sesame Database Link http://sesame.nysbc.org/sesame/ Link is sheherazade. Overview See Laboratory Information Management System SESAME.pptx. Register someone See ...

New York Structural Biology Center, Information Technology Department New York Structural Biology Center Using the NYSBC SFTP ...

Name: Shibani Bhattacharya Email: sbhattacharya@nysbc.org Company Name: NYSBC Company URL: Location: ParkBuildingOffice Country: USA ...

How to use Shutter box Control Application from TVIPS Background Tietz shutterbox has separate beam blank and camera shutter controls This allows beam to ...

Contents Instructions for processing Single particle crystals 1 Setup directories: mkdir doc mkdir patch mkdir coran mkdir classavg 2 Convert from mrc ...

Solid State Probe Status: Updated May 2026 NYSBC probe list Nov2019.pdf: Table of probes and spec's , indicates probes that are on site and ready for use. , indicates ...

Contents 1D Pulse Sequences COMMON NAME PP directory name Reference Limitations History Console NYSBC Compatible Cross Polarization ...

Name: Sourabh Banerjee Email: sob2004@med.cornell.edu Company Name: Company URL: Location: WMCCU Country: USA Comment: was with Sakmar ...

A general statement is attached. Please contact for any additions/ changes. Set ALLOWTOPICVIEW generalstatement.rtf: General statement for grants

Name: Steven Smith Email: steven.o.smith@sunysb.edu Company Name: Stony Brook University Company URL: http://sos.bio.sunysb.edu Location: SUNCYSBOffice ...

PROTOCOLS from Stokes Lab Members Cell Culture yeast growth protocol vink.doc: Yeast Culture (Martin Vink) 12/2007 Yeast cultures.doc: Yeast culture protocol ...

Sucrose Gradient Centrifugation protocol from Marisa Sublevel topic subsub level topic Set ALLOWTOPICVIEW RalphLasala 30 Jul 2013 protocol sucrose ...

TargetTrack TargetTrack, a target registration database, provides information on the experimental progress and status of targets selected for structural determination ...

Contents Sample Insertion InsertRoomTemperatureSample InsertCryoSample Tecnai F20 Problems Instructions to Retrieve CCDBlankEnable Film Jam Access ...

FEI TF20 Microscope Parameters wavelengths 200kV: 0.02508 A objective lenses f Cs 2.1 mm Chromatic aberration Aperture Sizes Condensor ...

TEMIMPS Annual Meeting, April 19, 2011 TEMIMPS annual meeting agenda.doc: Agenda TEMIMPS annual meeting materials.pdf: Meeting Materials TEMIMPS Guests ...

TEMIMPS annual meeting materials.doc: meeting materials workshop agenda 4 10 2012.doc: Pre meeting workshop TemimpsMeetingSchedule2012 Attending Title ...

3rd TEMIMPS Annual Meeting Boston April 30 May 1, 2013 TEMIMPS annual meeting directions.pdf: TEMIMPS annual meeting directions.pdf TEMIMPS Third annual ...

Transcontinential Initiative for Membrane Protein Structure Meetings Temimps Monthly Meetings TemimpsAnnualMeeting2013 TemimpsAnnualMeeting2012 ...

Schedule for the TEMIMPS Annual Meeting April 10 11, 2012 Tuesday April 10 10:00 David: detergent calculator 10:30 Nicolas: 2dx parameter matrix ...

Contents blank minutes page.doc: template for minutes TEMIMPS PImtg Oct 10 2012.txt TEMIMPS PImtg Sep 4 2012.txt PI Meeting in Washington DC 7/2012 TEMIMPS ...

Annual Report 5/1/2012 Quarterly Report 4/1/2012 Quarterly Report 1/1/2012 Quarterly Report 10/1/2011 Quarterly Report 7/1/2011 Annual Report: May 1, 2011 Quarterly ...

Workshop in Electron Crystallography The Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) is hosting a workshop in the theory and practice of ...

TEMIMPS Workshop in Electron Crystallography Lecture Materials August 15 19, 2011 University of Washington School of Medicine, Seattle, Washington Lectures Lecture ...

xtracedrop program for characterizing drop shape and quantifying detergent concentrations Contents Program Installation xtracedrop is a python program (xtracedrop ...

New NMR Temperature Calibration Protocol and Correction of old calibration sets Based on Findeisen et al. (Magn. Reson. Chem. 2007; 45: 175–178 findeisen2006 ...

Thermoshake Program tcontrol.zip Other info (from inheco contact) Attached is the DLL Command Set. you will find the description of the error 16 (No or false Modbus ...

Name: Thomas Szyperski Email: szypersk@chem.buffalo.edu Company Name: U at Buffalo Company URL: http://www.buffalo.edu Location: SUNYBuffaloOffice ...

Contents Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW DavidCowburn 26 Nov 2005

Name: Tom Muir Email: muirt@rockefeller.edu Company Name: Company URL: http://www.rockefeller.edu/research/abstract.php?id 121 http://www.princeton ...

Please revise these notes after reading the TopSpin 1.3 release letter http://www.nysbc.net/twiki/pub/Main/BrukerSoftwarenews/rellet1 3 ts.pdf Topspin 1.3 installation ...

2dx Crystallization experiments set at NYU Name of the topic Sublevel topic subsub level topic Set ALLOWTOPICVIEW NicolasCoudray 14 Jul 2014 Most recent ...

2D crystallization database Data mining from a recent review by Abeyrathne et al., which tabulated successful 2D crystallization experiments from the literature, allowed ...

2D Crystallization experiments Our Targets Reports Crystallization trials throughput (up to May 5, 2015): 2dxTrial SummaryReport.xlsx Status of all targets ...

2dx Controls X368 Controls in new 3D printed plate (square chambers) frozen protein tested: yiiP (Salvatore), yiiP (John), CysZ, Bor1p, YetJ, BAT14 Set in 3D printed ...

2dx AgrC 2D crystallization Contents Properties Amino acid sequence: MELLNSYNFVLFVLTQMILMFTIPAIISGIKYSKLDYFFIIGISTLSLFLFKMFDSASLIILTSFIIIMYFVKIKWYSILLIMTSQIILYCANYMYIVIYAYITKISDSIFVIFPSFFVVYVTISILFSYIINRVLKKISTPYLILNKGFLIVISTILLLTFSLFFFYSQINSDEAKVIRQYSFIFIGITIFLSILTFVISQFLLKEMKYKRNQEEIETYYEYTLKIEAINNEMRKFRHDYVNILTTLSEYIREDDMIGLRAYFNKNIVPMKDNLQMNAIKLNGIENLKVREIKGLITAKILRAQEMNIPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESENSVTFIVMNKCADDIPRIHELFQESFSTKGEGRGLGLSTLKEIADNADNVLLDTIIENGFFIQKVEIINN ...

2dx CD47 2D crystallization Info Protein from Ravi Human membrane proteins for 2D crystallization trial, CD47. It is stable during expression and purification from ...

2dx Claudin 15: 2D crystallization General 2dx information the protein can be frozen (still leads to 3D crystals) stable at 4C for 2 weeks at least ...

2dx CysZ Pseudomonas aeruginosa Transporter 2D crystallization Info 2 stains: PA01 and PA7 The first aeruginosa is Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 ...

2dx CysZ Pseudomonas fragi Transporter 2D crystallization X380 (November 2015). 8 samples 8 samples: sample Solubilization Purification Dialysis Gel ...

2dx EmrE (Lactobacillus plantarum) 2D crystallization trials Properties Amino acid sequence without tag: M T W I Y L I I G G L F E V V W A T M M K L S N G F ...

2dx gluconate transporter / permease; 2D crystallization Properties Amino acid sequence: MTPLDIQLLLTALASVLVLVALIVSRLKMHPLLALLVVSIGVGFATHMAPGSIVSHLLTGAGKTLGAVGVVIALGAMLGKILADAGVTEQVADVILKRTPDRMIPWAMMLVAFVIGIPMFFEVGLVIMLPLIFSVARKLESKARFKGSAYVYVGVPVISALAAMHGMVPPHPGPLTAIAVLKTSVGPTMLYGFLAAIPAMILGGPLYGMFISPRMNTRPDQALLDQFTLAEKADGQPRPGVMVGMLAALLPAILMLVHAVAEMLLPKGNALLEMASFLGNPLIAMLLGVLFAGASLVLARGGDAEQLRDALGKSLKPIASIIMIIAGGGAFQEMLTSAKVGDAIVHLTQQSAFPPLILGWLIAMLLSVSTGSATVGIVGAAGLLAPLAGADPSLNLPLLALSIGCGSLFFNYANHAGFWMVKESFGMTMGEATKTISVVQSIVAVVGLMVVLMLNAAITIG ...

2dx 2D crystallization trials of GtrB Properties Amino acid sequence: HHHHHHSSGVDLGTENLYFQSNATIELSIVIPMYNEEDNLEHLFARLLEVLTPLKITYEIICVNDGSKDKTLKQLIDCYQSNRQIKIVNLSRNFGKEIALSAGIDYAQGNAVIPIDADLQDPPELIHELVDKWREGYDIVYATRRSRQGETWVKQFTAKMFYKVIGRMTEIKIPPNTGDFRLMDRKVVNAIKQLPERTRFMKGLFAWVGYRQTFVLFDREPRFQGQTKWNYWKLWNFALDGIFSFSLLPLKVWTYLGSIISLLSLAYASFLILKTITLGVDVPGYASLMVAILFLGGVQLISLGVIGEYLGRVYEEVKARPLYLVSDLWGLEYLPLEKLN ...

2dx Kdp 2D crystallization Properties December 19, 2013 3 fractions from 2 frozen samples received: Kdp His: F8 (0.84 mg/ml), F9 (0.99 mg/ml), F10 (0.99mg/ml ...

2dx MDR 2D crystallization General 2dx information Amino acid sequence: MQRIIQFFSQRATTLFFPMALILYDFAAYLTTDLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGALIFTLACAATLLTTSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMGLLALCGLLLAMPETVQRGAVPFSAVSVLRDFRNVFRNPIFLTGAATLSLSYIPMMSWVAVSPVILIDAGGMSTSQFAWAQVPVFGAVIVANMIVVRLVKDPTRPRFIWRAVPIQLSGLATLLLGNLLLPHVWLWSVLGTSLYAFGIGMIFPTLFRFTLFSNNLPKGTVSASLNMVILTVMAVSVEVGRWLWFHGGRLPFHLLAAVAGVIVVFTLATLLQRVRQHEAAELAAEK ...

Calibration and Parameter setting of 2DX Robot Vacuum set points vacuum set points for insertion and extraction are contained in the file ~/robot software/robot ...

Robot Design Manuscript Set ALLOWTOPICVIEW DavidStokes 26 Sep 2009 Fig1.ai: fig 1 Fig2.ai: fig 2 Fig3.ai: fig 3 figure 4.ai: fig 4 Fig 5 ...

(15.4; 688.1; 0.1) Robot Manuals (leave this at the top) Controller manual RCX142 e.pdf: rcx142 manual (this is most useful) RCX143 144 e 0322 v1.02.pdf ...

Screening Results Manuscript Set ALLOWTOPICVIEW DavidStokes 26 Sep 2009 figure1.ai: fig 1 figure 2.ai: fig 2 fig 3.ai: fig 3 fig 4.ai: fig ...

2dx SoPIP 2D crystallization General Information Amino acid chain (A mutant) MGHHHHHHSSGVDLGTENLYFQSSMWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWP QALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQL ...

2dx UMA 2D crystallization Properties Amino acid sequence: MKLRLTDLAGPVGMGIFMLVVQILSLLLVAPLTDYYDLKAFENPQSVWNPVFYIVLIILFSAVLLLIIKFNMKWIIQLFMIFAVFSTLIYVLFGMGTMLLPPPQYGWEIILAASIIISILLTALMVVYPEWYIVDAVGIMVAAGASALFGISLSVIPTIILLVLLAVYDFIAVYKTKHMIKLAEGVMDLKLPILFVLPRKLSYSYVRSRTQKLEPGKEREAYFMGLGDAVMPTVLAVSASAFLEAPKVLGFANVPAIGVILGTLVSYAVLMYFVMKGKPQAGLPFLCTGAIAGFLLGCLAAGINPFF ...

2dx Yiip 2D crystallization trials General information sequence: MTQTSQYDFWVKLASRASVATALTLITIKLLAWLYSGSASMLASLTDSFADTLASIINFIA IRYAIVPADHDHRYGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVENATLGVV ...

2dx YjbB 2D crystallization Properties MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSRSVEKKPLAFCAGIGVTALVQSSNATTMLVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDLSWLSPLLIFIGVIFFLGRKQSRAGQLGRVGIGLGLI ...

2dx UMA mutant 2d crystallization Mutant of UMA. X209 Lipids at MSSM The UMA triple mutant solubilized in detergent 1% DDM and then Ni NTA purification was in ...

My Links .NysbcIntro your introduction to NYSBC .ATasteOfTWiki view a short introductory presentation on TWiki for beginners .WelcomeGuest starting ...

How to do things at NYSBC \ Facilities and Laboratories at NYSBC ("Groups") Notices to Affiliates and Staff Get Affiliate Statistics (slow) Programs ...

Main Web Preferences The following settings are web preferences of the Main web. These preferences overwrite the site level preferences in and , and can ...

Return to Cryo EM web page at http://www.nysbc.org/facilities/CEM Principles Protocols Protocols Wohlwend Jump to Principles Start up Preparation ...

Contents XPLOR NIH supported version Source http://nmr.cit.nih.gov/xplor nih/download.cgi Local sources xplor nih 2.16.0 db.tar.gz: V 16 required databases ...

Contents Yeast Bench Processed High Pressure Frozen/Freeze Substitution New Piston Seal 9051nm50 007.jpg: Worn out piston seal ...

Screening and Scanning EM Film Procedure with screen shots available on web site http://www.nysbc.org/facilities/CEM/Zeiss PhotoScan Usage.html Download MSWord ...